BLASTX nr result
ID: Bupleurum21_contig00023579
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00023579 (365 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002272496.1| PREDICTED: 60S ribosomal protein L38 isoform... 64 1e-08 ref|XP_002272538.1| PREDICTED: 60S ribosomal protein L38 isoform... 64 1e-08 ref|XP_002462980.1| hypothetical protein SORBIDRAFT_02g035760 [S... 64 1e-08 ref|XP_003546983.1| PREDICTED: 60S ribosomal protein L38-like [G... 64 2e-08 ref|XP_003543572.1| PREDICTED: 60S ribosomal protein L38 [Glycin... 64 2e-08 >ref|XP_002272496.1| PREDICTED: 60S ribosomal protein L38 isoform 1 [Vitis vinifera] Length = 69 Score = 64.3 bits (155), Expect = 1e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +3 Query: 3 CSKYLYTLCVHDAEKAEKLKQSLPPGLSVQDI 98 CSKYLYTLCV DAEKA+KLKQSLPPGLSVQD+ Sbjct: 38 CSKYLYTLCVFDAEKADKLKQSLPPGLSVQDL 69 >ref|XP_002272538.1| PREDICTED: 60S ribosomal protein L38 isoform 2 [Vitis vinifera] gi|297743847|emb|CBI36730.3| unnamed protein product [Vitis vinifera] Length = 96 Score = 64.3 bits (155), Expect = 1e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +3 Query: 3 CSKYLYTLCVHDAEKAEKLKQSLPPGLSVQDI 98 CSKYLYTLCV DAEKA+KLKQSLPPGLSVQD+ Sbjct: 65 CSKYLYTLCVFDAEKADKLKQSLPPGLSVQDL 96 >ref|XP_002462980.1| hypothetical protein SORBIDRAFT_02g035760 [Sorghum bicolor] gi|241926357|gb|EER99501.1| hypothetical protein SORBIDRAFT_02g035760 [Sorghum bicolor] Length = 69 Score = 63.9 bits (154), Expect = 1e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +3 Query: 3 CSKYLYTLCVHDAEKAEKLKQSLPPGLSVQDI 98 CSKYLYTLCVHDA+KA KLKQSLPPGL+VQ+I Sbjct: 38 CSKYLYTLCVHDADKANKLKQSLPPGLTVQEI 69 >ref|XP_003546983.1| PREDICTED: 60S ribosomal protein L38-like [Glycine max] Length = 100 Score = 63.5 bits (153), Expect = 2e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +3 Query: 3 CSKYLYTLCVHDAEKAEKLKQSLPPGLSVQDI 98 CSKYLYTLCV D+EKA+KLKQSLPPGLSVQD+ Sbjct: 69 CSKYLYTLCVFDSEKADKLKQSLPPGLSVQDV 100 >ref|XP_003543572.1| PREDICTED: 60S ribosomal protein L38 [Glycine max] Length = 69 Score = 63.5 bits (153), Expect = 2e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +3 Query: 3 CSKYLYTLCVHDAEKAEKLKQSLPPGLSVQDI 98 CSKYLYTLCV D+EKA+KLKQSLPPGLSVQD+ Sbjct: 38 CSKYLYTLCVFDSEKADKLKQSLPPGLSVQDV 69