BLASTX nr result
ID: Bupleurum21_contig00023576
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00023576 (601 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003593784.1| GRF zinc finger containing protein [Medicago... 48 4e-06 >ref|XP_003593784.1| GRF zinc finger containing protein [Medicago truncatula] gi|355482832|gb|AES64035.1| GRF zinc finger containing protein [Medicago truncatula] Length = 220 Score = 47.8 bits (112), Expect(2) = 4e-06 Identities = 19/35 (54%), Positives = 24/35 (68%) Frame = +3 Query: 42 WKKMTFLCNCGLMAVLKTSWTDTNPGRRFWGCPNY 146 WK+ F C CG+ + L T+WT NPGRRF+GC Y Sbjct: 24 WKRPQFKCRCGVDSPLCTAWTVENPGRRFFGCGLY 58 Score = 28.5 bits (62), Expect(2) = 4e-06 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = +1 Query: 250 CNFLHWYDEIGCPRCTQIIPGLLGKVD 330 CNF WYDE R ++I LL K D Sbjct: 66 CNFFKWYDEACSEREKKLINALLKKND 92