BLASTX nr result
ID: Bupleurum21_contig00023456
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00023456 (495 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002870090.1| hypothetical protein ARALYDRAFT_914938 [Arab... 67 1e-09 ref|NP_193504.1| peroxidase 41 [Arabidopsis thaliana] gi|2639755... 67 1e-09 ref|XP_004152462.1| PREDICTED: peroxidase 65-like [Cucumis sativus] 67 2e-09 gb|ABD65151.1| peroxidase, putative [Brassica oleracea] 66 3e-09 ref|XP_002318634.1| predicted protein [Populus trichocarpa] gi|2... 66 3e-09 >ref|XP_002870090.1| hypothetical protein ARALYDRAFT_914938 [Arabidopsis lyrata subsp. lyrata] gi|297315926|gb|EFH46349.1| hypothetical protein ARALYDRAFT_914938 [Arabidopsis lyrata subsp. lyrata] Length = 326 Score = 67.4 bits (163), Expect = 1e-09 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = +3 Query: 369 HLSLDYYAKTCPDFERIMLEVVTPKQASNPTTAAGTLRVFFH 494 +L+ DYY KTCPDF +I+ E VTPKQ PTTAAGTLR+FFH Sbjct: 25 NLTKDYYQKTCPDFSKIVRETVTPKQGQQPTTAAGTLRLFFH 66 >ref|NP_193504.1| peroxidase 41 [Arabidopsis thaliana] gi|26397556|sp|O23609.1|PER41_ARATH RecName: Full=Peroxidase 41; Short=Atperox P41; Flags: Precursor gi|2245128|emb|CAB10549.1| peroxidase like protein [Arabidopsis thaliana] gi|7268522|emb|CAB78772.1| peroxidase like protein [Arabidopsis thaliana] gi|332658534|gb|AEE83934.1| peroxidase 41 [Arabidopsis thaliana] Length = 326 Score = 67.4 bits (163), Expect = 1e-09 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = +3 Query: 369 HLSLDYYAKTCPDFERIMLEVVTPKQASNPTTAAGTLRVFFH 494 +L+ DYY KTCPDF +I+ E VTPKQ PTTAAGTLR+FFH Sbjct: 25 NLTKDYYQKTCPDFNKIVRETVTPKQGQQPTTAAGTLRLFFH 66 >ref|XP_004152462.1| PREDICTED: peroxidase 65-like [Cucumis sativus] Length = 332 Score = 67.0 bits (162), Expect = 2e-09 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = +3 Query: 363 HRHLSLDYYAKTCPDFERIMLEVVTPKQASNPTTAAGTLRVFFH 494 H LSL YY KTCPDFE+I+ E VT KQ ++P TAAGTLR+FFH Sbjct: 24 HSKLSLGYYQKTCPDFEKIIRETVTNKQITSPVTAAGTLRLFFH 67 >gb|ABD65151.1| peroxidase, putative [Brassica oleracea] Length = 329 Score = 65.9 bits (159), Expect = 3e-09 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = +3 Query: 369 HLSLDYYAKTCPDFERIMLEVVTPKQASNPTTAAGTLRVFFH 494 +L+ DYY KTCPDF +I+ + VT KQA PTTAAGTLRVFFH Sbjct: 27 NLTKDYYQKTCPDFSKIVRDTVTTKQAQQPTTAAGTLRVFFH 68 >ref|XP_002318634.1| predicted protein [Populus trichocarpa] gi|222859307|gb|EEE96854.1| predicted protein [Populus trichocarpa] Length = 321 Score = 65.9 bits (159), Expect = 3e-09 Identities = 28/47 (59%), Positives = 37/47 (78%) Frame = +3 Query: 354 AHSHRHLSLDYYAKTCPDFERIMLEVVTPKQASNPTTAAGTLRVFFH 494 + S +LS DYY ++CP+FE+I+ E +T KQ SNP TAAGTLR+FFH Sbjct: 12 SESKSNLSFDYYKRSCPNFEKIVRETITTKQMSNPATAAGTLRLFFH 58