BLASTX nr result
ID: Bupleurum21_contig00023350
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00023350 (260 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pdb|2XR7|A Chain A, Crystal Structure Of Nicotiana Tabacum Malon... 65 4e-09 dbj|BAD93691.1| malonyltransferase [Nicotiana tabacum] 65 6e-09 gb|AAO38058.1| malonyl-coenzyme A: anthocyanidin 3-O-glucoside-6... 63 3e-08 pdb|2E1V|A Chain A, Crystal Structure Of Dendranthema Morifolium... 62 6e-08 pdb|2E1T|A Chain A, Crystal Structure Of Dendranthema Morifolium... 62 6e-08 >pdb|2XR7|A Chain A, Crystal Structure Of Nicotiana Tabacum Malonyltransferase (Ntmat1) Complexed With Malonyl-Coa Length = 453 Score = 65.5 bits (158), Expect = 4e-09 Identities = 31/66 (46%), Positives = 43/66 (65%) Frame = +3 Query: 30 KNEKIVQDPSDIKVRGTFVITEANIQALKKIVSKKRPTITYMSSFTVVCAYLWTCFAKTR 209 K +V P KVRGTF+IT +I LK +V +RP +T+++SFTV CAY+WTC K+ Sbjct: 228 KXSDVVTPPD--KVRGTFIITRHDIGKLKNLVLTRRPKLTHVTSFTVTCAYVWTCIIKSE 285 Query: 210 ATVYKE 227 A +E Sbjct: 286 AATGEE 291 >dbj|BAD93691.1| malonyltransferase [Nicotiana tabacum] Length = 453 Score = 65.1 bits (157), Expect = 6e-09 Identities = 31/61 (50%), Positives = 42/61 (68%) Frame = +3 Query: 45 VQDPSDIKVRGTFVITEANIQALKKIVSKKRPTITYMSSFTVVCAYLWTCFAKTRATVYK 224 V P D KVRGTF+IT +I LK +V +RP +T+++SFTV CAY+WTC K+ A + Sbjct: 232 VVTPPD-KVRGTFIITRHDIGKLKNLVLTRRPKLTHVTSFTVTCAYVWTCIIKSEAATGE 290 Query: 225 E 227 E Sbjct: 291 E 291 >gb|AAO38058.1| malonyl-coenzyme A: anthocyanidin 3-O-glucoside-6''-O-malonyltransferase [Pericallis cruenta] Length = 461 Score = 62.8 bits (151), Expect = 3e-08 Identities = 33/68 (48%), Positives = 42/68 (61%) Frame = +3 Query: 54 PSDIKVRGTFVITEANIQALKKIVSKKRPTITYMSSFTVVCAYLWTCFAKTRATVYKEAH 233 P+D KVR TFV+T NI LKK V + P + YMSSFTV C Y+W+C AK+ + E Sbjct: 242 PTD-KVRSTFVLTRTNINLLKKKVLTQVPNLEYMSSFTVTCGYIWSCIAKSLVKI-GERK 299 Query: 234 KLDEAQNF 257 DE + F Sbjct: 300 GEDELEQF 307 >pdb|2E1V|A Chain A, Crystal Structure Of Dendranthema Morifolium Dmat, Seleno- Methionine Derivative gi|146387464|pdb|2E1V|B Chain B, Crystal Structure Of Dendranthema Morifolium Dmat, Seleno- Methionine Derivative Length = 454 Score = 61.6 bits (148), Expect = 6e-08 Identities = 29/52 (55%), Positives = 38/52 (73%) Frame = +3 Query: 54 PSDIKVRGTFVITEANIQALKKIVSKKRPTITYMSSFTVVCAYLWTCFAKTR 209 PSD K+R TF++T A I LK V + PT+ Y+SSFTV CAY+W+C AK+R Sbjct: 241 PSD-KLRATFILTRAVINQLKDRVLAQLPTLEYVSSFTVACAYIWSCIAKSR 291 >pdb|2E1T|A Chain A, Crystal Structure Of Dendranthema Morifolium Dmat Complexed With Malonyl-coa gi|146387238|pdb|2E1T|B Chain B, Crystal Structure Of Dendranthema Morifolium Dmat Complexed With Malonyl-coa gi|146387461|pdb|2E1U|A Chain A, Crystal Structure Of Dendranthema Morifolium Dmat gi|146387462|pdb|2E1U|B Chain B, Crystal Structure Of Dendranthema Morifolium Dmat gi|134287095|dbj|BAF50706.1| anthocyanin malonyltransferase homolog [Chrysanthemum x morifolium] Length = 454 Score = 61.6 bits (148), Expect = 6e-08 Identities = 29/52 (55%), Positives = 38/52 (73%) Frame = +3 Query: 54 PSDIKVRGTFVITEANIQALKKIVSKKRPTITYMSSFTVVCAYLWTCFAKTR 209 PSD K+R TF++T A I LK V + PT+ Y+SSFTV CAY+W+C AK+R Sbjct: 241 PSD-KLRATFILTRAVINQLKDRVLAQLPTLEYVSSFTVACAYIWSCIAKSR 291