BLASTX nr result
ID: Bupleurum21_contig00023246
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00023246 (412 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003557927.1| PREDICTED: metal tolerance protein 2-like [B... 64 1e-08 ref|XP_002520656.1| cation efflux protein/ zinc transporter, put... 64 1e-08 ref|XP_002321323.1| metal tolerance protein [Populus trichocarpa... 64 2e-08 tpg|DAA45331.1| TPA: hypothetical protein ZEAMMB73_489738 [Zea m... 63 2e-08 dbj|BAK07009.1| predicted protein [Hordeum vulgare subsp. vulgare] 63 2e-08 >ref|XP_003557927.1| PREDICTED: metal tolerance protein 2-like [Brachypodium distachyon] Length = 498 Score = 63.9 bits (154), Expect = 1e-08 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = -1 Query: 121 IITPICSFTSRLYWITKRAGERSGSGLMKANAWHHRADAV 2 + T S LYWITKRAGE+ GSGLMKANAWHHRADA+ Sbjct: 202 VTTLAISIKEGLYWITKRAGEKEGSGLMKANAWHHRADAI 241 >ref|XP_002520656.1| cation efflux protein/ zinc transporter, putative [Ricinus communis] gi|223540041|gb|EEF41618.1| cation efflux protein/ zinc transporter, putative [Ricinus communis] Length = 479 Score = 63.9 bits (154), Expect = 1e-08 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -1 Query: 88 LYWITKRAGERSGSGLMKANAWHHRADAV 2 LYWITKRAGER GSGLMKANAWHHRADA+ Sbjct: 213 LYWITKRAGERQGSGLMKANAWHHRADAI 241 >ref|XP_002321323.1| metal tolerance protein [Populus trichocarpa] gi|222862096|gb|EEE99638.1| metal tolerance protein [Populus trichocarpa] Length = 453 Score = 63.5 bits (153), Expect = 2e-08 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -1 Query: 88 LYWITKRAGERSGSGLMKANAWHHRADAV 2 LYW+TKRAGER GSGLMKANAWHHRADA+ Sbjct: 188 LYWVTKRAGERQGSGLMKANAWHHRADAI 216 >tpg|DAA45331.1| TPA: hypothetical protein ZEAMMB73_489738 [Zea mays] Length = 352 Score = 63.2 bits (152), Expect = 2e-08 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -1 Query: 103 SFTSRLYWITKRAGERSGSGLMKANAWHHRADAV 2 S LYWITKRAGE+ GSGLMKANAWHHRADA+ Sbjct: 210 SIKEGLYWITKRAGEKEGSGLMKANAWHHRADAI 243 >dbj|BAK07009.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 502 Score = 63.2 bits (152), Expect = 2e-08 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -1 Query: 103 SFTSRLYWITKRAGERSGSGLMKANAWHHRADAV 2 S LYWITKRAGE+ GSGLMKANAWHHRADA+ Sbjct: 212 SIKEGLYWITKRAGEKEGSGLMKANAWHHRADAI 245