BLASTX nr result
ID: Bupleurum21_contig00022475
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00022475 (284 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002277939.1| PREDICTED: poly(A) polymerase-like [Vitis vi... 73 3e-11 emb|CAN69980.1| hypothetical protein VITISV_011285 [Vitis vinifera] 73 3e-11 ref|XP_002515957.1| nucleic acid binding protein, putative [Rici... 65 4e-09 ref|XP_002516534.1| Poly(A) polymerase beta, putative [Ricinus c... 55 6e-06 >ref|XP_002277939.1| PREDICTED: poly(A) polymerase-like [Vitis vinifera] Length = 770 Score = 72.8 bits (177), Expect = 3e-11 Identities = 33/86 (38%), Positives = 56/86 (65%) Frame = -3 Query: 282 LPSYIFPDGYRRSRPPRQHHEQSSPIDEGCRPGSVGRQPRKRREFDVANAQGSPEKRQCS 103 +PSY+FP+GY+RSRP R ++Q DE CR GS + +++++ + + + ++ + Sbjct: 487 IPSYVFPEGYKRSRPQRPVNQQQG--DEACRTGSSEKHMKRKKDPEEVDVEQDKAAKRLT 544 Query: 102 ASPQKRDSLSPEIITHVDRDVPKECS 25 SPQ++DS+SPEII+H +ECS Sbjct: 545 ISPQRQDSVSPEIISHRFSSSSQECS 570 >emb|CAN69980.1| hypothetical protein VITISV_011285 [Vitis vinifera] Length = 778 Score = 72.8 bits (177), Expect = 3e-11 Identities = 33/86 (38%), Positives = 56/86 (65%) Frame = -3 Query: 282 LPSYIFPDGYRRSRPPRQHHEQSSPIDEGCRPGSVGRQPRKRREFDVANAQGSPEKRQCS 103 +PSY+FP+GY+RSRP R ++Q DE CR GS + +++++ + + + ++ + Sbjct: 478 IPSYVFPEGYKRSRPQRPVNQQQG--DEACRTGSSEKHMKRKKDPEEVDVEQDKAAKRLT 535 Query: 102 ASPQKRDSLSPEIITHVDRDVPKECS 25 SPQ++DS+SPEII+H +ECS Sbjct: 536 ISPQRQDSVSPEIISHRFSSSSQECS 561 >ref|XP_002515957.1| nucleic acid binding protein, putative [Ricinus communis] gi|223544862|gb|EEF46377.1| nucleic acid binding protein, putative [Ricinus communis] Length = 712 Score = 65.5 bits (158), Expect = 4e-09 Identities = 36/95 (37%), Positives = 55/95 (57%), Gaps = 7/95 (7%) Frame = -3 Query: 282 LPSYIFPDGYRRSRPPRQHHEQSSPIDEGC-------RPGSVGRQPRKRREFDVANAQGS 124 +PSY+FPDGYRR+R PR +Q S D+ C GS R +++++ D + + Sbjct: 449 IPSYVFPDGYRRARHPRVTAQQQS--DKTCCGDSDAYGNGSSERGHKRKKDSDEIDVKND 506 Query: 123 PEKRQCSASPQKRDSLSPEIITHVDRDVPKECSLL 19 +++ S SPQ+RDS+SP+I TH ECS + Sbjct: 507 MPEKRNSISPQRRDSVSPDIFTHKFGGPSSECSAI 541 >ref|XP_002516534.1| Poly(A) polymerase beta, putative [Ricinus communis] gi|223544354|gb|EEF45875.1| Poly(A) polymerase beta, putative [Ricinus communis] Length = 754 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/75 (34%), Positives = 46/75 (61%), Gaps = 3/75 (4%) Frame = -3 Query: 282 LPSYIFPDGYRRSRPPRQHHEQS---SPIDEGCRPGSVGRQPRKRREFDVANAQGSPEKR 112 LP+++FPDGY+RSR R ++Q+ S + R GSV +++ + +V + + ++ Sbjct: 495 LPAFVFPDGYKRSRTSRHPNQQAGKPSDVSATSRAGSVEGHLKRKNDHEVVDVRPDKPEK 554 Query: 111 QCSASPQKRDSLSPE 67 + S SPQ+ S+SPE Sbjct: 555 RASVSPQRLQSVSPE 569