BLASTX nr result
ID: Bupleurum21_contig00022330
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00022330 (493 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW90565.1| chlorophyll a-b binding protein 3C-like mRNA [Sol... 80 2e-13 gb|AAB61236.1| chlorophyll a/b-binding protein [Mesembryanthemum... 80 2e-13 gb|AAA34150.1| chlorophyll a/b-binding protein Cab-1A, partial [... 80 2e-13 gb|AAA34148.1| chlorophyll a/b-binding protein Cab-3C [Solanum l... 80 2e-13 gb|AAA33396.1| light-harvesting chlorophyll a/b protein precurso... 80 2e-13 >gb|AFW90565.1| chlorophyll a-b binding protein 3C-like mRNA [Solanum tuberosum] Length = 233 Score = 79.7 bits (195), Expect = 2e-13 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = +3 Query: 3 FVQAIVTGKGPQENLADHLADPVNNNSWAFATNFVPGK 116 FVQAIVTGKGP ENLADHLADPVNNN+WAFATNFVPGK Sbjct: 196 FVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK 233 >gb|AAB61236.1| chlorophyll a/b-binding protein [Mesembryanthemum crystallinum] Length = 267 Score = 79.7 bits (195), Expect = 2e-13 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = +3 Query: 3 FVQAIVTGKGPQENLADHLADPVNNNSWAFATNFVPGK 116 FVQAIVTGKGP ENLADHLADPVNNN+WAFATNFVPGK Sbjct: 230 FVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK 267 >gb|AAA34150.1| chlorophyll a/b-binding protein Cab-1A, partial [Solanum lycopersicum] gi|170414|gb|AAA34152.1| chlorophyll a/b-binding protein Cab-1C, partial [Solanum lycopersicum] Length = 116 Score = 79.7 bits (195), Expect = 2e-13 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = +3 Query: 3 FVQAIVTGKGPQENLADHLADPVNNNSWAFATNFVPGK 116 FVQAIVTGKGP ENLADHLADPVNNN+WAFATNFVPGK Sbjct: 79 FVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK 116 >gb|AAA34148.1| chlorophyll a/b-binding protein Cab-3C [Solanum lycopersicum] Length = 267 Score = 79.7 bits (195), Expect = 2e-13 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = +3 Query: 3 FVQAIVTGKGPQENLADHLADPVNNNSWAFATNFVPGK 116 FVQAIVTGKGP ENLADHLADPVNNN+WAFATNFVPGK Sbjct: 230 FVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK 267 >gb|AAA33396.1| light-harvesting chlorophyll a/b protein precursor [Lemna gibba] Length = 266 Score = 79.7 bits (195), Expect = 2e-13 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = +3 Query: 3 FVQAIVTGKGPQENLADHLADPVNNNSWAFATNFVPGK 116 FVQAIVTGKGP ENLADHLADPVNNN+WAFATNFVPGK Sbjct: 229 FVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK 266