BLASTX nr result
ID: Bupleurum21_contig00021904
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00021904 (317 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002283991.1| PREDICTED: uncharacterized protein LOC100264... 71 8e-11 ref|XP_002511168.1| conserved hypothetical protein [Ricinus comm... 67 2e-09 ref|XP_002321708.1| predicted protein [Populus trichocarpa] gi|2... 67 2e-09 gb|AFK48728.1| unknown [Medicago truncatula] 64 1e-08 ref|XP_003579617.1| PREDICTED: uncharacterized protein LOC100837... 64 1e-08 >ref|XP_002283991.1| PREDICTED: uncharacterized protein LOC100264705 [Vitis vinifera] gi|147789866|emb|CAN73869.1| hypothetical protein VITISV_001275 [Vitis vinifera] gi|297734439|emb|CBI15686.3| unnamed protein product [Vitis vinifera] Length = 174 Score = 71.2 bits (173), Expect = 8e-11 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = -3 Query: 315 EERASTLRKELANKNKYLKVLMDQLRELINDVSTWQSPC 199 EERAS LRKELA+KNKYLK+L+DQLR+LI D+STWQSPC Sbjct: 134 EERASNLRKELADKNKYLKLLIDQLRDLITDISTWQSPC 172 >ref|XP_002511168.1| conserved hypothetical protein [Ricinus communis] gi|223550283|gb|EEF51770.1| conserved hypothetical protein [Ricinus communis] Length = 196 Score = 67.0 bits (162), Expect = 2e-09 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = -3 Query: 315 EERASTLRKELANKNKYLKVLMDQLRELINDVSTWQSPC 199 EE+AS LRKEL NKN YLK+L+DQLR+LI D+STWQSPC Sbjct: 156 EEQASNLRKELFNKNAYLKLLIDQLRDLITDISTWQSPC 194 >ref|XP_002321708.1| predicted protein [Populus trichocarpa] gi|222868704|gb|EEF05835.1| predicted protein [Populus trichocarpa] Length = 177 Score = 67.0 bits (162), Expect = 2e-09 Identities = 29/39 (74%), Positives = 36/39 (92%) Frame = -3 Query: 315 EERASTLRKELANKNKYLKVLMDQLRELINDVSTWQSPC 199 EERAS+LRKELA KN Y+K+L+DQLRE+I D+STWQ+PC Sbjct: 137 EERASSLRKELAKKNTYVKLLIDQLREIITDISTWQTPC 175 >gb|AFK48728.1| unknown [Medicago truncatula] Length = 179 Score = 64.3 bits (155), Expect = 1e-08 Identities = 29/38 (76%), Positives = 35/38 (92%) Frame = -3 Query: 315 EERASTLRKELANKNKYLKVLMDQLRELINDVSTWQSP 202 EE+AS+LRKEL NKN +LK+L+DQLRELI D+STWQSP Sbjct: 139 EEQASSLRKELGNKNLHLKILIDQLRELITDISTWQSP 176 >ref|XP_003579617.1| PREDICTED: uncharacterized protein LOC100837441 [Brachypodium distachyon] Length = 177 Score = 63.9 bits (154), Expect = 1e-08 Identities = 29/41 (70%), Positives = 36/41 (87%) Frame = -3 Query: 315 EERASTLRKELANKNKYLKVLMDQLRELINDVSTWQSPCLA 193 EERAS LRKE+ +KNK+LK+L+DQLR LI+D+S WQSPC A Sbjct: 137 EERASALRKEIESKNKHLKLLIDQLRGLISDISMWQSPCSA 177