BLASTX nr result
ID: Bupleurum21_contig00021671
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00021671 (275 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519637.1| conserved hypothetical protein [Ricinus comm... 69 5e-10 ref|XP_002305342.1| predicted protein [Populus trichocarpa] gi|2... 68 9e-10 ref|XP_003607806.1| hypothetical protein MTR_4g083110 [Medicago ... 66 3e-09 ref|XP_003524154.1| PREDICTED: CBL-interacting serine/threonine-... 65 4e-09 ref|XP_002525962.1| hypothetical protein RCOM_0596970 [Ricinus c... 65 4e-09 >ref|XP_002519637.1| conserved hypothetical protein [Ricinus communis] gi|223541054|gb|EEF42610.1| conserved hypothetical protein [Ricinus communis] Length = 89 Score = 68.6 bits (166), Expect = 5e-10 Identities = 31/51 (60%), Positives = 43/51 (84%) Frame = +1 Query: 106 MANARLTRFVTEVAPPQIVSVMRSRASKILDTINEDEREINVNDSHTMNPT 258 MAN+R+ RF+TEVAPPQ +SV+R RASK+LDTINE+ER+++ ++S PT Sbjct: 1 MANSRIARFITEVAPPQYISVIRRRASKMLDTINEEERDVSPSNSLASAPT 51 >ref|XP_002305342.1| predicted protein [Populus trichocarpa] gi|222848306|gb|EEE85853.1| predicted protein [Populus trichocarpa] Length = 84 Score = 67.8 bits (164), Expect = 9e-10 Identities = 28/51 (54%), Positives = 43/51 (84%) Frame = +1 Query: 106 MANARLTRFVTEVAPPQIVSVMRSRASKILDTINEDEREINVNDSHTMNPT 258 MAN+R+ +F+TE APPQ ++V+R RASK+LDTI+E++R++ +DS M+PT Sbjct: 1 MANSRIAKFITEAAPPQYINVIRQRASKLLDTISEEDRDVAASDSSPMSPT 51 >ref|XP_003607806.1| hypothetical protein MTR_4g083110 [Medicago truncatula] gi|355508861|gb|AES90003.1| hypothetical protein MTR_4g083110 [Medicago truncatula] Length = 85 Score = 65.9 bits (159), Expect = 3e-09 Identities = 31/45 (68%), Positives = 37/45 (82%) Frame = +1 Query: 106 MANARLTRFVTEVAPPQIVSVMRSRASKILDTINEDEREINVNDS 240 MAN+R+ RF EVAPPQ VSVMR R SK+++TI ED+REIN NDS Sbjct: 1 MANSRIARFFMEVAPPQYVSVMRHRTSKMMETITEDDREINSNDS 45 >ref|XP_003524154.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 23-like [Glycine max] Length = 621 Score = 65.5 bits (158), Expect = 4e-09 Identities = 33/50 (66%), Positives = 40/50 (80%) Frame = +1 Query: 106 MANARLTRFVTEVAPPQIVSVMRSRASKILDTINEDEREINVNDSHTMNP 255 MAN+R+ RF EVAPPQ V+VMR R SK+LDTI EDEREI+ +DS M+P Sbjct: 1 MANSRIARFFMEVAPPQYVTVMRHRTSKMLDTITEDEREISTSDS-VMSP 49 >ref|XP_002525962.1| hypothetical protein RCOM_0596970 [Ricinus communis] gi|223534694|gb|EEF36386.1| hypothetical protein RCOM_0596970 [Ricinus communis] Length = 79 Score = 65.5 bits (158), Expect = 4e-09 Identities = 29/51 (56%), Positives = 43/51 (84%) Frame = +1 Query: 106 MANARLTRFVTEVAPPQIVSVMRSRASKILDTINEDEREINVNDSHTMNPT 258 MA++R+ +F+TEVAPPQ +SVMR RASK+LDTINE+ER+++ ++S P+ Sbjct: 1 MASSRIAKFITEVAPPQYISVMRHRASKMLDTINEEERDVSPSNSLASAPS 51