BLASTX nr result
ID: Bupleurum21_contig00021094
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00021094 (609 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002522477.1| xenotropic and polytropic murine leukemia vi... 88 1e-15 ref|XP_002315034.1| pho1-like protein [Populus trichocarpa] gi|2... 87 2e-15 ref|XP_002337324.1| predicted small molecule transporter [Populu... 87 2e-15 ref|XP_002312260.1| pho1-like protein [Populus trichocarpa] gi|2... 87 2e-15 ref|XP_002522478.1| xenotropic and polytropic murine leukemia vi... 86 4e-15 >ref|XP_002522477.1| xenotropic and polytropic murine leukemia virus receptor pho1, putative [Ricinus communis] gi|223538362|gb|EEF39969.1| xenotropic and polytropic murine leukemia virus receptor pho1, putative [Ricinus communis] Length = 784 Score = 88.2 bits (217), Expect = 1e-15 Identities = 39/65 (60%), Positives = 46/65 (70%) Frame = -2 Query: 302 RTAYSVDKSVSWKXXXXXXXXXXXXSGTYWDLVYDWGLLDRKSKNRWLRDRLLVPHKYVY 123 RTAYS++K SW+ GTYWDLV+DWGLL R SKNRWLRD+LLVP K VY Sbjct: 643 RTAYSLNKGTSWRVAAWIFSVIAALYGTYWDLVFDWGLLQRHSKNRWLRDKLLVPRKSVY 702 Query: 122 YVAMV 108 ++AMV Sbjct: 703 FIAMV 707 >ref|XP_002315034.1| pho1-like protein [Populus trichocarpa] gi|222864074|gb|EEF01205.1| pho1-like protein [Populus trichocarpa] Length = 763 Score = 87.4 bits (215), Expect = 2e-15 Identities = 39/65 (60%), Positives = 46/65 (70%) Frame = -2 Query: 302 RTAYSVDKSVSWKXXXXXXXXXXXXSGTYWDLVYDWGLLDRKSKNRWLRDRLLVPHKYVY 123 RTAY+++K +WK GTYWDLV+DWGLL R SKNRWLRD+LLVPHK VY Sbjct: 622 RTAYNINKGDNWKAIAWVFSSIAAIFGTYWDLVFDWGLLQRHSKNRWLRDKLLVPHKSVY 681 Query: 122 YVAMV 108 + AMV Sbjct: 682 FGAMV 686 >ref|XP_002337324.1| predicted small molecule transporter [Populus trichocarpa] gi|222838776|gb|EEE77127.1| predicted small molecule transporter [Populus trichocarpa] Length = 173 Score = 87.4 bits (215), Expect = 2e-15 Identities = 39/68 (57%), Positives = 46/68 (67%) Frame = -2 Query: 302 RTAYSVDKSVSWKXXXXXXXXXXXXSGTYWDLVYDWGLLDRKSKNRWLRDRLLVPHKYVY 123 RTAY+++ W+ GTYWDLV+DWGLL R SKNRWLRD+LLVPHK VY Sbjct: 92 RTAYNINNGDGWRAIAWVFSSVAAIIGTYWDLVFDWGLLQRHSKNRWLRDKLLVPHKSVY 151 Query: 122 YVAMVGSK 99 + AMV SK Sbjct: 152 FGAMVSSK 159 >ref|XP_002312260.1| pho1-like protein [Populus trichocarpa] gi|222852080|gb|EEE89627.1| pho1-like protein [Populus trichocarpa] Length = 795 Score = 87.0 bits (214), Expect = 2e-15 Identities = 39/65 (60%), Positives = 46/65 (70%) Frame = -2 Query: 302 RTAYSVDKSVSWKXXXXXXXXXXXXSGTYWDLVYDWGLLDRKSKNRWLRDRLLVPHKYVY 123 RTAYS++K VSW+ TYWDLV+DWGLL R SKNRWLRD+LLVPH+ VY Sbjct: 654 RTAYSLNKGVSWRAIAWIFSAIATIFSTYWDLVFDWGLLQRHSKNRWLRDKLLVPHRSVY 713 Query: 122 YVAMV 108 + AMV Sbjct: 714 FGAMV 718 >ref|XP_002522478.1| xenotropic and polytropic murine leukemia virus receptor pho1, putative [Ricinus communis] gi|223538363|gb|EEF39970.1| xenotropic and polytropic murine leukemia virus receptor pho1, putative [Ricinus communis] Length = 779 Score = 86.3 bits (212), Expect = 4e-15 Identities = 39/67 (58%), Positives = 45/67 (67%) Frame = -2 Query: 302 RTAYSVDKSVSWKXXXXXXXXXXXXSGTYWDLVYDWGLLDRKSKNRWLRDRLLVPHKYVY 123 RTAYS++K +W GTYWDLV+DWGLL R SKNRWLRD+LLVP K VY Sbjct: 638 RTAYSLNKGYAWGVIAVIFSVLAALFGTYWDLVFDWGLLQRNSKNRWLRDKLLVPRKSVY 697 Query: 122 YVAMVGS 102 Y AMV + Sbjct: 698 YAAMVAN 704