BLASTX nr result
ID: Bupleurum21_contig00020842
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00020842 (470 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAJ34294.1| unnamed protein product [Thellungiella halophila] 96 2e-18 dbj|BAJ33636.1| unnamed protein product [Thellungiella halophila] 96 4e-18 ref|XP_002438053.1| hypothetical protein SORBIDRAFT_10g007330 [S... 96 4e-18 ref|XP_002438052.1| hypothetical protein SORBIDRAFT_10g007320 [S... 96 4e-18 emb|CAN75591.1| hypothetical protein VITISV_034561 [Vitis vinifera] 96 4e-18 >dbj|BAJ34294.1| unnamed protein product [Thellungiella halophila] Length = 367 Score = 96.3 bits (238), Expect = 2e-18 Identities = 42/47 (89%), Positives = 45/47 (95%) Frame = +3 Query: 3 YGRVFLANPDLPKRFELNAPLNKYDRSTFYTSDPVVGYTDYPFLDQT 143 YGR FLANPDLP+RF+LNAPLNKYDRSTFYTSDPVVGYTDYPFL+ T Sbjct: 317 YGRTFLANPDLPRRFQLNAPLNKYDRSTFYTSDPVVGYTDYPFLENT 363 >dbj|BAJ33636.1| unnamed protein product [Thellungiella halophila] Length = 374 Score = 95.5 bits (236), Expect = 4e-18 Identities = 41/47 (87%), Positives = 47/47 (100%) Frame = +3 Query: 3 YGRVFLANPDLPKRFELNAPLNKYDRSTFYTSDPVVGYTDYPFLDQT 143 YGR+FLANPDLPKRF+++APLNKYDR+TFYTSDPVVGYTDYPFL+QT Sbjct: 327 YGRLFLANPDLPKRFQVDAPLNKYDRATFYTSDPVVGYTDYPFLEQT 373 >ref|XP_002438053.1| hypothetical protein SORBIDRAFT_10g007330 [Sorghum bicolor] gi|241916276|gb|EER89420.1| hypothetical protein SORBIDRAFT_10g007330 [Sorghum bicolor] Length = 385 Score = 95.5 bits (236), Expect = 4e-18 Identities = 42/45 (93%), Positives = 44/45 (97%) Frame = +3 Query: 3 YGRVFLANPDLPKRFELNAPLNKYDRSTFYTSDPVVGYTDYPFLD 137 YGR+FLANPDLPKRFELNAPLNKYDRSTFYT DPVVGYTDYPFL+ Sbjct: 329 YGRLFLANPDLPKRFELNAPLNKYDRSTFYTQDPVVGYTDYPFLE 373 >ref|XP_002438052.1| hypothetical protein SORBIDRAFT_10g007320 [Sorghum bicolor] gi|241916275|gb|EER89419.1| hypothetical protein SORBIDRAFT_10g007320 [Sorghum bicolor] Length = 385 Score = 95.5 bits (236), Expect = 4e-18 Identities = 42/45 (93%), Positives = 44/45 (97%) Frame = +3 Query: 3 YGRVFLANPDLPKRFELNAPLNKYDRSTFYTSDPVVGYTDYPFLD 137 YGR+FLANPDLPKRFELNAPLNKYDRSTFYT DPVVGYTDYPFL+ Sbjct: 329 YGRLFLANPDLPKRFELNAPLNKYDRSTFYTQDPVVGYTDYPFLE 373 >emb|CAN75591.1| hypothetical protein VITISV_034561 [Vitis vinifera] Length = 97 Score = 95.5 bits (236), Expect = 4e-18 Identities = 41/47 (87%), Positives = 46/47 (97%) Frame = +3 Query: 3 YGRVFLANPDLPKRFELNAPLNKYDRSTFYTSDPVVGYTDYPFLDQT 143 +GR+FLANPDLPKRFEL+ PLN+YDRSTFYTSDP+VGYTDYPFLDQT Sbjct: 50 FGRLFLANPDLPKRFELDIPLNRYDRSTFYTSDPIVGYTDYPFLDQT 96