BLASTX nr result
ID: Bupleurum21_contig00020502
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00020502 (360 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK36982.1| unknown [Medicago truncatula] 72 6e-11 ref|XP_003613588.1| F-box/FBD/LRR-repeat protein [Medicago trunc... 72 6e-11 ref|XP_002521998.1| ubiquitin-protein ligase, putative [Ricinus ... 71 8e-11 emb|CAN82914.1| hypothetical protein VITISV_031085 [Vitis vinifera] 70 2e-10 ref|XP_002522000.1| ubiquitin-protein ligase, putative [Ricinus ... 68 7e-10 >gb|AFK36982.1| unknown [Medicago truncatula] Length = 418 Score = 71.6 bits (174), Expect = 6e-11 Identities = 36/64 (56%), Positives = 45/64 (70%) Frame = -3 Query: 196 MTSDAKRRHNGTAVDRISSLPRNLIDLILQCLPVRDAARTSILSRTWRDMWGTLPQLVFN 17 MT K+ + G +DRIS LP N+ID ILQ L +RD ARTSILSR WRD+W + P L F+ Sbjct: 1 MTLSNKKANYGDHLDRISDLPSNVIDGILQHLNIRDLARTSILSRKWRDIWISFPWLEFD 60 Query: 16 DEFF 5 +FF Sbjct: 61 KDFF 64 >ref|XP_003613588.1| F-box/FBD/LRR-repeat protein [Medicago truncatula] gi|355514923|gb|AES96546.1| F-box/FBD/LRR-repeat protein [Medicago truncatula] Length = 499 Score = 71.6 bits (174), Expect = 6e-11 Identities = 36/64 (56%), Positives = 45/64 (70%) Frame = -3 Query: 196 MTSDAKRRHNGTAVDRISSLPRNLIDLILQCLPVRDAARTSILSRTWRDMWGTLPQLVFN 17 MT K+ + G +DRIS LP N+ID ILQ L +RD ARTSILSR WRD+W + P L F+ Sbjct: 82 MTLSNKKANYGDHLDRISDLPSNVIDGILQHLNIRDLARTSILSRKWRDIWISFPWLEFD 141 Query: 16 DEFF 5 +FF Sbjct: 142 KDFF 145 >ref|XP_002521998.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223538802|gb|EEF40402.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 437 Score = 71.2 bits (173), Expect = 8e-11 Identities = 29/54 (53%), Positives = 42/54 (77%) Frame = -3 Query: 166 GTAVDRISSLPRNLIDLILQCLPVRDAARTSILSRTWRDMWGTLPQLVFNDEFF 5 G+ +DRIS LP N+ID IL CLP++DA RTS LS+ W++ W T+PQ++ ++ FF Sbjct: 7 GSGLDRISDLPSNVIDHILACLPLKDAVRTSTLSKKWKEKWHTVPQIIVDENFF 60 >emb|CAN82914.1| hypothetical protein VITISV_031085 [Vitis vinifera] Length = 341 Score = 69.7 bits (169), Expect = 2e-10 Identities = 35/51 (68%), Positives = 37/51 (72%) Frame = -3 Query: 160 AVDRISSLPRNLIDLILQCLPVRDAARTSILSRTWRDMWGTLPQLVFNDEF 8 A DRIS LP N+ID IL LP+ DA RTSILSR WR W TLPQLVF D F Sbjct: 7 AADRISXLPSNIIDBILVRLPIHDAVRTSILSRKWRYKWLTLPQLVFEDSF 57 >ref|XP_002522000.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223538804|gb|EEF40404.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 429 Score = 68.2 bits (165), Expect = 7e-10 Identities = 30/59 (50%), Positives = 42/59 (71%) Frame = -3 Query: 181 KRRHNGTAVDRISSLPRNLIDLILQCLPVRDAARTSILSRTWRDMWGTLPQLVFNDEFF 5 +R + G+ +DRIS LP N+ID IL CLP +DA RTS LS+ W++ W +PQ+V + FF Sbjct: 2 ERIYVGSGLDRISDLPSNVIDHILACLPFKDAVRTSTLSKKWKEKWHMVPQIVVDKNFF 60