BLASTX nr result
ID: Bupleurum21_contig00020433
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00020433 (273 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002868182.1| hypothetical protein ARALYDRAFT_355191 [Arab... 62 6e-08 dbj|BAD94026.1| hypothetical protein [Arabidopsis thaliana] 59 3e-07 ref|XP_002515156.1| monoxygenase, putative [Ricinus communis] gi... 55 8e-06 >ref|XP_002868182.1| hypothetical protein ARALYDRAFT_355191 [Arabidopsis lyrata subsp. lyrata] gi|297314018|gb|EFH44441.1| hypothetical protein ARALYDRAFT_355191 [Arabidopsis lyrata subsp. lyrata] Length = 408 Score = 61.6 bits (148), Expect = 6e-08 Identities = 31/54 (57%), Positives = 42/54 (77%) Frame = -2 Query: 272 ERRMRIVVLSTQTYLTGLLITESTSLLLKFACILLMLMLFRDASAHTKYDCGTL 111 ERR R+V LSTQTYLTG LI +++S + KF ++L+++LFRD HT+YDCG L Sbjct: 356 ERRGRLVGLSTQTYLTGNLI-KASSPVTKFLLVVLLMILFRDQIGHTRYDCGRL 408 >dbj|BAD94026.1| hypothetical protein [Arabidopsis thaliana] Length = 205 Score = 59.3 bits (142), Expect = 3e-07 Identities = 30/54 (55%), Positives = 40/54 (74%) Frame = -2 Query: 272 ERRMRIVVLSTQTYLTGLLITESTSLLLKFACILLMLMLFRDASAHTKYDCGTL 111 ERR R+V LSTQTYLTG LI S S + K ++++++LFRD HT+YDCG+L Sbjct: 153 ERRGRLVGLSTQTYLTGSLIAAS-SPVRKLLLVVMLMILFRDQIGHTRYDCGSL 205 >ref|XP_002515156.1| monoxygenase, putative [Ricinus communis] gi|223545636|gb|EEF47140.1| monoxygenase, putative [Ricinus communis] Length = 397 Score = 54.7 bits (130), Expect = 8e-06 Identities = 28/54 (51%), Positives = 40/54 (74%) Frame = -2 Query: 272 ERRMRIVVLSTQTYLTGLLITESTSLLLKFACILLMLMLFRDASAHTKYDCGTL 111 ERRMR+V LSTQTYL G L+ +++S L+K + + M++LF + HT+YDCG L Sbjct: 345 ERRMRLVWLSTQTYLYGSLL-QNSSRLVKVSIAVAMIVLFGNPIYHTRYDCGPL 397