BLASTX nr result
ID: Bupleurum21_contig00020265
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00020265 (353 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004148735.1| PREDICTED: mitochondrial carnitine/acylcarni... 65 4e-09 ref|NP_001240194.1| uncharacterized protein LOC100787304 [Glycin... 65 4e-09 ref|NP_001240170.1| uncharacterized protein LOC100791908 [Glycin... 65 4e-09 ref|XP_002519821.1| Protein dif-1, putative [Ricinus communis] g... 65 4e-09 ref|XP_004148479.1| PREDICTED: mitochondrial carnitine/acylcarni... 63 2e-08 >ref|XP_004148735.1| PREDICTED: mitochondrial carnitine/acylcarnitine carrier-like protein-like isoform 1 [Cucumis sativus] gi|449462013|ref|XP_004148736.1| PREDICTED: mitochondrial carnitine/acylcarnitine carrier-like protein-like isoform 2 [Cucumis sativus] gi|449523403|ref|XP_004168713.1| PREDICTED: mitochondrial carnitine/acylcarnitine carrier-like protein-like isoform 1 [Cucumis sativus] gi|449523405|ref|XP_004168714.1| PREDICTED: mitochondrial carnitine/acylcarnitine carrier-like protein-like isoform 2 [Cucumis sativus] Length = 297 Score = 65.5 bits (158), Expect = 4e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 95 MGDVAKDLSAGTVGGAAQLICGHPFDTIKVK 3 MGDVAKDL+AGTVGGAAQLICGHPFDTIKVK Sbjct: 1 MGDVAKDLTAGTVGGAAQLICGHPFDTIKVK 31 >ref|NP_001240194.1| uncharacterized protein LOC100787304 [Glycine max] gi|255640648|gb|ACU20609.1| unknown [Glycine max] Length = 297 Score = 65.5 bits (158), Expect = 4e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 95 MGDVAKDLSAGTVGGAAQLICGHPFDTIKVK 3 MGDVAKDL+AGTVGGAAQLICGHPFDTIKVK Sbjct: 1 MGDVAKDLAAGTVGGAAQLICGHPFDTIKVK 31 >ref|NP_001240170.1| uncharacterized protein LOC100791908 [Glycine max] gi|255636690|gb|ACU18681.1| unknown [Glycine max] Length = 297 Score = 65.5 bits (158), Expect = 4e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 95 MGDVAKDLSAGTVGGAAQLICGHPFDTIKVK 3 MGDVAKDL+AGTVGGAAQLICGHPFDTIKVK Sbjct: 1 MGDVAKDLAAGTVGGAAQLICGHPFDTIKVK 31 >ref|XP_002519821.1| Protein dif-1, putative [Ricinus communis] gi|223540867|gb|EEF42425.1| Protein dif-1, putative [Ricinus communis] Length = 297 Score = 65.5 bits (158), Expect = 4e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 95 MGDVAKDLSAGTVGGAAQLICGHPFDTIKVK 3 MGDVAKDL+AGTVGGAAQLICGHPFDTIKVK Sbjct: 1 MGDVAKDLTAGTVGGAAQLICGHPFDTIKVK 31 >ref|XP_004148479.1| PREDICTED: mitochondrial carnitine/acylcarnitine carrier-like protein-like [Cucumis sativus] gi|449530915|ref|XP_004172437.1| PREDICTED: mitochondrial carnitine/acylcarnitine carrier-like protein-like [Cucumis sativus] Length = 296 Score = 63.2 bits (152), Expect = 2e-08 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -1 Query: 95 MGDVAKDLSAGTVGGAAQLICGHPFDTIKVK 3 MGDVAKDL++GT+GGAAQLICGHPFDTIKVK Sbjct: 1 MGDVAKDLASGTLGGAAQLICGHPFDTIKVK 31