BLASTX nr result
ID: Bupleurum21_contig00020252
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00020252 (357 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003525673.1| PREDICTED: denticleless protein homolog [Gly... 84 9e-15 ref|XP_003554813.1| PREDICTED: denticleless protein homolog [Gly... 84 2e-14 ref|XP_002521461.1| Cell division cycle protein cdt2, putative [... 84 2e-14 ref|XP_003618215.1| Coatomer subunit beta'-1 [Medicago truncatul... 80 2e-13 ref|XP_003618155.1| Coatomer protein complex subunit alpha [Medi... 80 2e-13 >ref|XP_003525673.1| PREDICTED: denticleless protein homolog [Glycine max] Length = 509 Score = 84.3 bits (207), Expect = 9e-15 Identities = 38/54 (70%), Positives = 45/54 (83%), Gaps = 3/54 (5%) Frame = -3 Query: 355 KKCLGVLLGHTGSIKSICSHPTNHDVVVSGSRGGSFALWDLRC---AESRQGAV 203 +KCLGVL GHTGS+KS+CSHPTN D++VSGSR GSF +WDLRC A+SR G V Sbjct: 138 QKCLGVLTGHTGSVKSMCSHPTNSDIIVSGSRDGSFRIWDLRCKSTAKSRHGEV 191 >ref|XP_003554813.1| PREDICTED: denticleless protein homolog [Glycine max] Length = 506 Score = 83.6 bits (205), Expect = 2e-14 Identities = 38/55 (69%), Positives = 46/55 (83%), Gaps = 3/55 (5%) Frame = -3 Query: 355 KKCLGVLLGHTGSIKSICSHPTNHDVVVSGSRGGSFALWDLRC---AESRQGAVS 200 +KCLG+L GHTGS+KS+CSHPTN D++VSGSR GSF +WDLRC A+SR G VS Sbjct: 138 QKCLGLLTGHTGSVKSMCSHPTNSDIIVSGSRDGSFRIWDLRCKSTAKSRCGEVS 192 >ref|XP_002521461.1| Cell division cycle protein cdt2, putative [Ricinus communis] gi|223539360|gb|EEF40951.1| Cell division cycle protein cdt2, putative [Ricinus communis] Length = 502 Score = 83.6 bits (205), Expect = 2e-14 Identities = 35/52 (67%), Positives = 44/52 (84%) Frame = -3 Query: 355 KKCLGVLLGHTGSIKSICSHPTNHDVVVSGSRGGSFALWDLRCAESRQGAVS 200 KKC+GVL+GHTGSIKS+CSHPTN D++VSGSR GSFA WDLRC + + ++ Sbjct: 135 KKCIGVLMGHTGSIKSMCSHPTNSDILVSGSRDGSFATWDLRCNTTSKSEIT 186 >ref|XP_003618215.1| Coatomer subunit beta'-1 [Medicago truncatula] gi|355493230|gb|AES74433.1| Coatomer subunit beta'-1 [Medicago truncatula] Length = 424 Score = 80.1 bits (196), Expect = 2e-13 Identities = 39/54 (72%), Positives = 43/54 (79%), Gaps = 2/54 (3%) Frame = -3 Query: 355 KKCLGVLLGHTGSIKSICSHPTNHDVVVSGSRGGSFALWDLRC--AESRQGAVS 200 KKCLGVL GHTGS+KSI SHPTN D+ VSGSR GSF LWDLRC +R+G VS Sbjct: 68 KKCLGVLTGHTGSVKSISSHPTNPDISVSGSRDGSFRLWDLRCNSNSNRRGEVS 121 >ref|XP_003618155.1| Coatomer protein complex subunit alpha [Medicago truncatula] gi|355493170|gb|AES74373.1| Coatomer protein complex subunit alpha [Medicago truncatula] Length = 504 Score = 79.7 bits (195), Expect = 2e-13 Identities = 38/53 (71%), Positives = 43/53 (81%), Gaps = 2/53 (3%) Frame = -3 Query: 355 KKCLGVLLGHTGSIKSICSHPTNHDVVVSGSRGGSFALWDLRC--AESRQGAV 203 KKCLGVL GHTGS+KSI SHPTN D++VSGSR GSF LWDLRC +R+G V Sbjct: 140 KKCLGVLTGHTGSVKSISSHPTNPDILVSGSRDGSFRLWDLRCNSNSNRRGEV 192