BLASTX nr result
ID: Bupleurum21_contig00019396
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00019396 (295 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527875.1| conserved hypothetical protein [Ricinus comm... 62 4e-08 ref|XP_002277232.1| PREDICTED: uncharacterized protein C3orf32-l... 59 5e-07 emb|CAN72578.1| hypothetical protein VITISV_001136 [Vitis vinifera] 57 1e-06 >ref|XP_002527875.1| conserved hypothetical protein [Ricinus communis] gi|223532726|gb|EEF34506.1| conserved hypothetical protein [Ricinus communis] Length = 426 Score = 62.4 bits (150), Expect = 4e-08 Identities = 32/45 (71%), Positives = 36/45 (80%), Gaps = 6/45 (13%) Frame = +3 Query: 177 MEEPLIS------GGKESEKWSTYQYVGRSGSVLPTSSLAGTEVS 293 MEEPL+S KESEKWS+YQYVGR+GSV PT+SLAGTEVS Sbjct: 1 MEEPLLSEKRSEVDEKESEKWSSYQYVGRTGSVFPTASLAGTEVS 45 >ref|XP_002277232.1| PREDICTED: uncharacterized protein C3orf32-like [Vitis vinifera] Length = 432 Score = 58.5 bits (140), Expect = 5e-07 Identities = 30/51 (58%), Positives = 38/51 (74%), Gaps = 6/51 (11%) Frame = +3 Query: 159 MEQQSNMEEPLIS------GGKESEKWSTYQYVGRSGSVLPTSSLAGTEVS 293 ME+Q ME P +S KES++ S+YQYVGR+GSV+PT+SLAGTEVS Sbjct: 1 MEEQQTMEVPFLSEAKSEIADKESKRLSSYQYVGRTGSVIPTASLAGTEVS 51 >emb|CAN72578.1| hypothetical protein VITISV_001136 [Vitis vinifera] Length = 467 Score = 57.4 bits (137), Expect = 1e-06 Identities = 30/51 (58%), Positives = 37/51 (72%), Gaps = 6/51 (11%) Frame = +3 Query: 159 MEQQSNMEEPLIS------GGKESEKWSTYQYVGRSGSVLPTSSLAGTEVS 293 ME+Q ME P +S KES + S+YQYVGR+GSV+PT+SLAGTEVS Sbjct: 1 MEEQQTMEVPXLSEAKSEIADKESXRLSSYQYVGRTGSVIPTASLAGTEVS 51