BLASTX nr result
ID: Bupleurum21_contig00019293
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00019293 (377 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002297882.1| predicted protein [Populus trichocarpa] gi|2... 60 2e-07 ref|XP_002267989.1| PREDICTED: probable FKBP-type peptidyl-proly... 59 3e-07 ref|NP_001241480.1| uncharacterized protein LOC100797411 [Glycin... 59 5e-07 ref|XP_004152320.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 57 1e-06 ref|XP_002512679.1| fk506-binding protein, putative [Ricinus com... 57 1e-06 >ref|XP_002297882.1| predicted protein [Populus trichocarpa] gi|222845140|gb|EEE82687.1| predicted protein [Populus trichocarpa] Length = 202 Score = 60.1 bits (144), Expect = 2e-07 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +2 Query: 299 RIIVPPELGYPENDYNKSGPRPTTFS 376 RIIVPPELGYPENDYNKSGPRPTTFS Sbjct: 147 RIIVPPELGYPENDYNKSGPRPTTFS 172 >ref|XP_002267989.1| PREDICTED: probable FKBP-type peptidyl-prolyl cis-trans isomerase 7, chloroplastic isoform 1 [Vitis vinifera] gi|296085536|emb|CBI29268.3| unnamed protein product [Vitis vinifera] Length = 257 Score = 59.3 bits (142), Expect = 3e-07 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +2 Query: 281 SYSKLCRIIVPPELGYPENDYNKSGPRPTTFS 376 S + RIIVPPELGYPEND+NKSGPRPTTFS Sbjct: 195 SLGSIRRIIVPPELGYPENDFNKSGPRPTTFS 226 >ref|NP_001241480.1| uncharacterized protein LOC100797411 [Glycine max] gi|255646496|gb|ACU23726.1| unknown [Glycine max] Length = 241 Score = 58.5 bits (140), Expect = 5e-07 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 299 RIIVPPELGYPENDYNKSGPRPTTFS 376 RIIVPPELGYPEND+NKSGPRPTTFS Sbjct: 185 RIIVPPELGYPENDFNKSGPRPTTFS 210 >ref|XP_004152320.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic-like [Cucumis sativus] gi|449522654|ref|XP_004168341.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic-like [Cucumis sativus] Length = 257 Score = 57.4 bits (137), Expect = 1e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 299 RIIVPPELGYPENDYNKSGPRPTTFS 376 RIIVPPELGYP+NDYNK GPRPTTFS Sbjct: 198 RIIVPPELGYPDNDYNKKGPRPTTFS 223 >ref|XP_002512679.1| fk506-binding protein, putative [Ricinus communis] gi|223548640|gb|EEF50131.1| fk506-binding protein, putative [Ricinus communis] Length = 246 Score = 57.4 bits (137), Expect = 1e-06 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = +2 Query: 299 RIIVPPELGYPENDYNKSGPRPTTFS 376 RIIVPPELGYPEND+N+SGPRPTTFS Sbjct: 190 RIIVPPELGYPENDFNRSGPRPTTFS 215