BLASTX nr result
ID: Bupleurum21_contig00019031
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00019031 (424 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004139907.1| PREDICTED: ALA-interacting subunit 3-like [C... 67 2e-09 ref|XP_002516421.1| conserved hypothetical protein [Ricinus comm... 67 2e-09 ref|XP_002265244.1| PREDICTED: ALA-interacting subunit 3 [Vitis ... 67 2e-09 ref|XP_002316154.1| predicted protein [Populus trichocarpa] gi|2... 65 6e-09 ref|XP_002311284.1| predicted protein [Populus trichocarpa] gi|2... 65 6e-09 >ref|XP_004139907.1| PREDICTED: ALA-interacting subunit 3-like [Cucumis sativus] gi|449475853|ref|XP_004154570.1| PREDICTED: ALA-interacting subunit 3-like [Cucumis sativus] Length = 343 Score = 66.6 bits (161), Expect = 2e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +3 Query: 333 RRNSKRPKYSRFTQQELPACKPILTPKWVI 422 RRNSKRPKYSRFTQQELPACKPILTP+WVI Sbjct: 16 RRNSKRPKYSRFTQQELPACKPILTPRWVI 45 >ref|XP_002516421.1| conserved hypothetical protein [Ricinus communis] gi|223544456|gb|EEF45976.1| conserved hypothetical protein [Ricinus communis] Length = 350 Score = 66.6 bits (161), Expect = 2e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +3 Query: 333 RRNSKRPKYSRFTQQELPACKPILTPKWVI 422 RRNSKRPKYSRFTQQELPACKPILTP+WVI Sbjct: 22 RRNSKRPKYSRFTQQELPACKPILTPRWVI 51 >ref|XP_002265244.1| PREDICTED: ALA-interacting subunit 3 [Vitis vinifera] gi|297736110|emb|CBI24148.3| unnamed protein product [Vitis vinifera] Length = 349 Score = 66.6 bits (161), Expect = 2e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +3 Query: 333 RRNSKRPKYSRFTQQELPACKPILTPKWVI 422 RRNSKRPKYSRFTQQELPACKPILTP+WVI Sbjct: 22 RRNSKRPKYSRFTQQELPACKPILTPRWVI 51 >ref|XP_002316154.1| predicted protein [Populus trichocarpa] gi|222865194|gb|EEF02325.1| predicted protein [Populus trichocarpa] Length = 350 Score = 65.1 bits (157), Expect = 6e-09 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 333 RRNSKRPKYSRFTQQELPACKPILTPKWVI 422 RRNSKRPKYS+FTQQELPACKPILTP+WV+ Sbjct: 22 RRNSKRPKYSKFTQQELPACKPILTPRWVV 51 >ref|XP_002311284.1| predicted protein [Populus trichocarpa] gi|222851104|gb|EEE88651.1| predicted protein [Populus trichocarpa] Length = 350 Score = 65.1 bits (157), Expect = 6e-09 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 333 RRNSKRPKYSRFTQQELPACKPILTPKWVI 422 RRNSKRPKYS+FTQQELPACKPILTP+WV+ Sbjct: 22 RRNSKRPKYSKFTQQELPACKPILTPRWVV 51