BLASTX nr result
ID: Bupleurum21_contig00018912
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00018912 (383 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003589534.1| GDSL esterase/lipase [Medicago truncatula] g... 73 3e-11 tpg|DAA64318.1| TPA: anther-specific proline-rich protein APG [Z... 70 2e-10 tpg|DAA64317.1| TPA: hypothetical protein ZEAMMB73_242688 [Zea m... 70 2e-10 gb|ACR34471.1| unknown [Zea mays] 70 2e-10 gb|ACG32957.1| anther-specific proline-rich protein APG precurso... 70 2e-10 >ref|XP_003589534.1| GDSL esterase/lipase [Medicago truncatula] gi|355478582|gb|AES59785.1| GDSL esterase/lipase [Medicago truncatula] Length = 361 Score = 72.8 bits (177), Expect = 3e-11 Identities = 30/49 (61%), Positives = 39/49 (79%) Frame = -1 Query: 380 LEVSVLCNKFSPTCPDPTKFLFWDSYHPTETGYRLLVDNILGRYINKLI 234 LEV+VLCN TC D ++++FWDSYHPTE YR LVD++L RY+N+LI Sbjct: 313 LEVAVLCNPLDATCSDASEYVFWDSYHPTERAYRKLVDSVLERYLNRLI 361 >tpg|DAA64318.1| TPA: anther-specific proline-rich protein APG [Zea mays] Length = 404 Score = 69.7 bits (169), Expect = 2e-10 Identities = 29/51 (56%), Positives = 39/51 (76%), Gaps = 1/51 (1%) Frame = -1 Query: 383 DLEVSVLCNKFS-PTCPDPTKFLFWDSYHPTETGYRLLVDNILGRYINKLI 234 DLEVS+LCN+ + PTCPD K++FWDS+HPTE Y ++VD + RYI L+ Sbjct: 354 DLEVSLLCNQLTAPTCPDDRKYVFWDSFHPTEKAYEIIVDYLFPRYIENLL 404 >tpg|DAA64317.1| TPA: hypothetical protein ZEAMMB73_242688 [Zea mays] Length = 410 Score = 69.7 bits (169), Expect = 2e-10 Identities = 29/51 (56%), Positives = 39/51 (76%), Gaps = 1/51 (1%) Frame = -1 Query: 383 DLEVSVLCNKFS-PTCPDPTKFLFWDSYHPTETGYRLLVDNILGRYINKLI 234 DLEVS+LCN+ + PTCPD K++FWDS+HPTE Y ++VD + RYI L+ Sbjct: 360 DLEVSLLCNQLTAPTCPDDRKYVFWDSFHPTEKAYEIIVDYLFPRYIENLL 410 >gb|ACR34471.1| unknown [Zea mays] Length = 353 Score = 69.7 bits (169), Expect = 2e-10 Identities = 29/51 (56%), Positives = 39/51 (76%), Gaps = 1/51 (1%) Frame = -1 Query: 383 DLEVSVLCNKFS-PTCPDPTKFLFWDSYHPTETGYRLLVDNILGRYINKLI 234 DLEVS+LCN+ + PTCPD K++FWDS+HPTE Y ++VD + RYI L+ Sbjct: 303 DLEVSLLCNQLTAPTCPDDRKYVFWDSFHPTEKAYEIIVDYLFPRYIENLL 353 >gb|ACG32957.1| anther-specific proline-rich protein APG precursor [Zea mays] Length = 353 Score = 69.7 bits (169), Expect = 2e-10 Identities = 29/51 (56%), Positives = 39/51 (76%), Gaps = 1/51 (1%) Frame = -1 Query: 383 DLEVSVLCNKFS-PTCPDPTKFLFWDSYHPTETGYRLLVDNILGRYINKLI 234 DLEVS+LCN+ + PTCPD K++FWDS+HPTE Y ++VD + RYI L+ Sbjct: 303 DLEVSLLCNQLTAPTCPDDRKYVFWDSFHPTEKAYEIIVDYLFPRYIENLL 353