BLASTX nr result
ID: Bupleurum21_contig00018900
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00018900 (329 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_198883.1| cystinosin [Arabidopsis thaliana] gi|13124057|s... 64 1e-08 gb|AAM63025.1| unknown [Arabidopsis thaliana] 64 1e-08 ref|XP_002870687.1| PQ-loop repeat family protein [Arabidopsis l... 61 8e-08 ref|XP_002268329.1| PREDICTED: cystinosin homolog [Vitis vinifer... 59 5e-07 ref|XP_002323998.1| predicted protein [Populus trichocarpa] gi|1... 56 3e-06 >ref|NP_198883.1| cystinosin [Arabidopsis thaliana] gi|13124057|sp|P57758.1|CTNS_ARATH RecName: Full=Cystinosin homolog gi|9758095|dbj|BAB08539.1| unnamed protein product [Arabidopsis thaliana] gi|15529266|gb|AAK97727.1| AT5g40670/MNF13_190 [Arabidopsis thaliana] gi|16974419|gb|AAL31135.1| AT5g40670/MNF13_190 [Arabidopsis thaliana] gi|332007197|gb|AED94580.1| cystinosin [Arabidopsis thaliana] Length = 270 Score = 63.9 bits (154), Expect = 1e-08 Identities = 29/51 (56%), Positives = 38/51 (74%) Frame = -1 Query: 329 IGKTLLSLVSVFFDILFILQHYVFYPVMKTTKLPTVDVASKKPLIESSDDN 177 +GKTLLSL+S+FFDILF+ QHYV YP K +K P S +PLI+SS ++ Sbjct: 219 MGKTLLSLISIFFDILFMFQHYVLYPEKKVSKSPETGEESNEPLIDSSHEH 269 >gb|AAM63025.1| unknown [Arabidopsis thaliana] Length = 270 Score = 63.9 bits (154), Expect = 1e-08 Identities = 29/51 (56%), Positives = 38/51 (74%) Frame = -1 Query: 329 IGKTLLSLVSVFFDILFILQHYVFYPVMKTTKLPTVDVASKKPLIESSDDN 177 +GKTLLSL+S+FFDILF+ QHYV YP K +K P S +PLI+SS ++ Sbjct: 219 MGKTLLSLISIFFDILFMCQHYVLYPEKKVSKSPETSEESNEPLIDSSHEH 269 >ref|XP_002870687.1| PQ-loop repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297316523|gb|EFH46946.1| PQ-loop repeat family protein [Arabidopsis lyrata subsp. lyrata] Length = 270 Score = 61.2 bits (147), Expect = 8e-08 Identities = 29/51 (56%), Positives = 37/51 (72%) Frame = -1 Query: 329 IGKTLLSLVSVFFDILFILQHYVFYPVMKTTKLPTVDVASKKPLIESSDDN 177 IGKTLLSL+S+FFDILF+ QHYV YP K +K S +PLI+SS ++ Sbjct: 219 IGKTLLSLISIFFDILFMFQHYVLYPEKKASKSLETGEESNEPLIDSSHEH 269 >ref|XP_002268329.1| PREDICTED: cystinosin homolog [Vitis vinifera] gi|296081321|emb|CBI17703.3| unnamed protein product [Vitis vinifera] Length = 274 Score = 58.5 bits (140), Expect = 5e-07 Identities = 28/49 (57%), Positives = 36/49 (73%) Frame = -1 Query: 329 IGKTLLSLVSVFFDILFILQHYVFYPVMKTTKLPTVDVASKKPLIESSD 183 IGK L+SLVSVFFD++FI QHY+ YP K K P + S++PLI+S D Sbjct: 219 IGKLLISLVSVFFDLVFISQHYLLYPGKKVGKCPKLGDESREPLIKSVD 267 >ref|XP_002323998.1| predicted protein [Populus trichocarpa] gi|118485298|gb|ABK94508.1| unknown [Populus trichocarpa] gi|222867000|gb|EEF04131.1| predicted protein [Populus trichocarpa] Length = 274 Score = 55.8 bits (133), Expect = 3e-06 Identities = 28/57 (49%), Positives = 39/57 (68%) Frame = -1 Query: 329 IGKTLLSLVSVFFDILFILQHYVFYPVMKTTKLPTVDVASKKPLIESSDDNAHVEDV 159 IGKTLLSLVS+FFD++F+ QHY+ YP K P ++ +PLI S++ A E+V Sbjct: 219 IGKTLLSLVSIFFDLVFMCQHYILYPENKAVP-PKLNKEGTEPLIRFSEEPAAPENV 274