BLASTX nr result
ID: Bupleurum21_contig00018668
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00018668 (439 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002279505.2| PREDICTED: chloroplastic group IIA intron sp... 59 4e-07 emb|CBI27903.3| unnamed protein product [Vitis vinifera] 59 4e-07 ref|XP_002309217.1| predicted protein [Populus trichocarpa] gi|2... 57 2e-06 >ref|XP_002279505.2| PREDICTED: chloroplastic group IIA intron splicing facilitator CRS1, chloroplastic-like [Vitis vinifera] Length = 884 Score = 58.9 bits (141), Expect = 4e-07 Identities = 28/47 (59%), Positives = 32/47 (68%), Gaps = 4/47 (8%) Frame = +2 Query: 2 TVQFDTQQTN----PAKKKRKPRPSFSEQIEDKWSVKTTSLRQKFPW 130 ++Q DTQQ K KRKPRPSF EQI DKWS+K S R+KFPW Sbjct: 39 SIQVDTQQVKVPLKTTKAKRKPRPSFFEQIRDKWSLKINSPREKFPW 85 >emb|CBI27903.3| unnamed protein product [Vitis vinifera] Length = 881 Score = 58.9 bits (141), Expect = 4e-07 Identities = 28/47 (59%), Positives = 32/47 (68%), Gaps = 4/47 (8%) Frame = +2 Query: 2 TVQFDTQQTN----PAKKKRKPRPSFSEQIEDKWSVKTTSLRQKFPW 130 ++Q DTQQ K KRKPRPSF EQI DKWS+K S R+KFPW Sbjct: 81 SIQVDTQQVKVPLKTTKAKRKPRPSFFEQIRDKWSLKINSPREKFPW 127 >ref|XP_002309217.1| predicted protein [Populus trichocarpa] gi|222855193|gb|EEE92740.1| predicted protein [Populus trichocarpa] Length = 977 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/38 (65%), Positives = 28/38 (73%) Frame = +2 Query: 17 TQQTNPAKKKRKPRPSFSEQIEDKWSVKTTSLRQKFPW 130 T Q + AK KRKP+PSF EQI KWS+K TS R KFPW Sbjct: 38 TVQVHAAKSKRKPKPSFFEQIHHKWSLKLTSTRDKFPW 75