BLASTX nr result
ID: Bupleurum21_contig00017938
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00017938 (481 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002285483.2| PREDICTED: auxin-responsive protein IAA13-li... 83 3e-14 emb|CBI23724.3| unnamed protein product [Vitis vinifera] 83 3e-14 ref|XP_002285481.1| PREDICTED: auxin-responsive protein IAA13-li... 83 3e-14 gb|AFP54302.1| ARF domain class transcription factor [Pyrus x br... 81 1e-13 gb|ADL36583.1| ARF domain class transcription factor [Malus x do... 81 1e-13 >ref|XP_002285483.2| PREDICTED: auxin-responsive protein IAA13-like isoform 2 [Vitis vinifera] Length = 321 Score = 82.8 bits (203), Expect = 3e-14 Identities = 37/46 (80%), Positives = 41/46 (89%) Frame = -1 Query: 481 DWMLVGDVPWRMFLNTAKRLRIMKTSEANGLAPRFQERHDRQKKPP 344 DWMLVGDVPW MFL+T KRLRIM+TSEANGLAPRFQER +RQ+ P Sbjct: 275 DWMLVGDVPWGMFLSTVKRLRIMRTSEANGLAPRFQERSERQRSKP 320 >emb|CBI23724.3| unnamed protein product [Vitis vinifera] Length = 283 Score = 82.8 bits (203), Expect = 3e-14 Identities = 37/46 (80%), Positives = 41/46 (89%) Frame = -1 Query: 481 DWMLVGDVPWRMFLNTAKRLRIMKTSEANGLAPRFQERHDRQKKPP 344 DWMLVGDVPW MFL+T KRLRIM+TSEANGLAPRFQER +RQ+ P Sbjct: 237 DWMLVGDVPWGMFLSTVKRLRIMRTSEANGLAPRFQERSERQRSKP 282 >ref|XP_002285481.1| PREDICTED: auxin-responsive protein IAA13-like isoform 1 [Vitis vinifera] Length = 314 Score = 82.8 bits (203), Expect = 3e-14 Identities = 37/46 (80%), Positives = 41/46 (89%) Frame = -1 Query: 481 DWMLVGDVPWRMFLNTAKRLRIMKTSEANGLAPRFQERHDRQKKPP 344 DWMLVGDVPW MFL+T KRLRIM+TSEANGLAPRFQER +RQ+ P Sbjct: 268 DWMLVGDVPWGMFLSTVKRLRIMRTSEANGLAPRFQERSERQRSKP 313 >gb|AFP54302.1| ARF domain class transcription factor [Pyrus x bretschneideri] Length = 306 Score = 80.9 bits (198), Expect = 1e-13 Identities = 36/46 (78%), Positives = 40/46 (86%) Frame = -1 Query: 481 DWMLVGDVPWRMFLNTAKRLRIMKTSEANGLAPRFQERHDRQKKPP 344 DWMLVGDVPW MFL + KRLRIM+TSEANGLAPRFQER +RQ+ P Sbjct: 260 DWMLVGDVPWGMFLGSVKRLRIMRTSEANGLAPRFQERSERQRNKP 305 >gb|ADL36583.1| ARF domain class transcription factor [Malus x domestica] Length = 306 Score = 80.9 bits (198), Expect = 1e-13 Identities = 36/46 (78%), Positives = 40/46 (86%) Frame = -1 Query: 481 DWMLVGDVPWRMFLNTAKRLRIMKTSEANGLAPRFQERHDRQKKPP 344 DWMLVGDVPW MFL + KRLRIM+TSEANGLAPRFQER +RQ+ P Sbjct: 260 DWMLVGDVPWGMFLGSVKRLRIMRTSEANGLAPRFQERSERQRNKP 305