BLASTX nr result
ID: Bupleurum21_contig00017760
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00017760 (285 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAD24818.1| cell attachment protein in somatic embryogenesis... 150 1e-34 ref|XP_002285446.2| PREDICTED: epidermis-specific secreted glyco... 112 4e-23 ref|XP_002317422.1| predicted protein [Populus trichocarpa] gi|2... 111 5e-23 ref|XP_002525646.1| Epidermis-specific secreted glycoprotein EP1... 107 1e-21 ref|XP_002525645.1| Epidermis-specific secreted glycoprotein EP1... 106 2e-21 >dbj|BAD24818.1| cell attachment protein in somatic embryogenesis [Daucus carota] gi|55785663|dbj|BAD72577.1| cell attachment protein in somatic embryogenesis [Daucus carota] Length = 443 Score = 150 bits (378), Expect = 1e-34 Identities = 70/71 (98%), Positives = 70/71 (98%) Frame = +2 Query: 71 AQAVVPANATFKYTNEGELGEYIVEYDASYRTLPIARFPFQFCFYNTTPTAFILGLRMGN 250 AQAVVPANATFKYTNEGELGEYIVEYDASYRTLPIARFPFQFCFYNTTPTAFILGLRMGN Sbjct: 23 AQAVVPANATFKYTNEGELGEYIVEYDASYRTLPIARFPFQFCFYNTTPTAFILGLRMGN 82 Query: 251 RRSESTMRWVW 283 R SESTMRWVW Sbjct: 83 RHSESTMRWVW 93 >ref|XP_002285446.2| PREDICTED: epidermis-specific secreted glycoprotein EP1-like [Vitis vinifera] Length = 429 Score = 112 bits (279), Expect = 4e-23 Identities = 51/71 (71%), Positives = 54/71 (76%) Frame = +2 Query: 71 AQAVVPANATFKYTNEGELGEYIVEYDASYRTLPIARFPFQFCFYNTTPTAFILGLRMGN 250 AQA VP N+TFKY NEGE G YIVEYD +YRTLPI PFQFCFYNTTP A+ L LRM Sbjct: 24 AQASVPINSTFKYVNEGEFGPYIVEYDGNYRTLPIFASPFQFCFYNTTPNAYTLALRMAT 83 Query: 251 RRSESTMRWVW 283 RSES RWVW Sbjct: 84 TRSESLFRWVW 94 >ref|XP_002317422.1| predicted protein [Populus trichocarpa] gi|222860487|gb|EEE98034.1| predicted protein [Populus trichocarpa] Length = 414 Score = 111 bits (278), Expect = 5e-23 Identities = 49/69 (71%), Positives = 56/69 (81%) Frame = +2 Query: 77 AVVPANATFKYTNEGELGEYIVEYDASYRTLPIARFPFQFCFYNTTPTAFILGLRMGNRR 256 A VP++ TFKY N+GE GEY VEY A YR LP++ FPFQ CFYNTTP A+ LGLRMG+RR Sbjct: 1 ATVPSSKTFKYINQGEFGEYSVEYLADYRVLPLSTFPFQLCFYNTTPNAYTLGLRMGHRR 60 Query: 257 SESTMRWVW 283 SES MRWVW Sbjct: 61 SESIMRWVW 69 >ref|XP_002525646.1| Epidermis-specific secreted glycoprotein EP1 precursor, putative [Ricinus communis] gi|223535082|gb|EEF36764.1| Epidermis-specific secreted glycoprotein EP1 precursor, putative [Ricinus communis] Length = 427 Score = 107 bits (267), Expect = 1e-21 Identities = 51/71 (71%), Positives = 53/71 (74%) Frame = +2 Query: 71 AQAVVPANATFKYTNEGELGEYIVEYDASYRTLPIARFPFQFCFYNTTPTAFILGLRMGN 250 A A VP +ATFKY NEGE GEYIVEYDA+YR L PFQ CFYNTTP AF L LRMG Sbjct: 20 AHASVPPSATFKYVNEGEFGEYIVEYDANYRVLDPFAQPFQLCFYNTTPNAFTLALRMGT 79 Query: 251 RRSESTMRWVW 283 RSES MRWVW Sbjct: 80 VRSESLMRWVW 90 >ref|XP_002525645.1| Epidermis-specific secreted glycoprotein EP1 precursor, putative [Ricinus communis] gi|223535081|gb|EEF36763.1| Epidermis-specific secreted glycoprotein EP1 precursor, putative [Ricinus communis] Length = 424 Score = 106 bits (265), Expect = 2e-21 Identities = 51/71 (71%), Positives = 53/71 (74%) Frame = +2 Query: 71 AQAVVPANATFKYTNEGELGEYIVEYDASYRTLPIARFPFQFCFYNTTPTAFILGLRMGN 250 AQA VP +ATFKY NEGE GEYIVEYDA+YR L PFQ CFYNTTP AF L LRMG Sbjct: 24 AQASVPPSATFKYINEGEFGEYIVEYDANYRVLDPFAQPFQLCFYNTTPNAFTLALRMGT 83 Query: 251 RRSESTMRWVW 283 RS S MRWVW Sbjct: 84 VRSTSRMRWVW 94