BLASTX nr result
ID: Bupleurum21_contig00017745
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00017745 (297 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003592305.1| Dihydrodipicolinate reductase [Medicago trun... 73 2e-11 emb|CBI31836.3| unnamed protein product [Vitis vinifera] 72 6e-11 ref|XP_002274702.1| PREDICTED: putative dihydrodipicolinate redu... 72 6e-11 ref|XP_003556086.1| PREDICTED: putative dihydrodipicolinate redu... 71 1e-10 ref|XP_003536480.1| PREDICTED: putative dihydrodipicolinate redu... 71 1e-10 >ref|XP_003592305.1| Dihydrodipicolinate reductase [Medicago truncatula] gi|355481353|gb|AES62556.1| Dihydrodipicolinate reductase [Medicago truncatula] Length = 302 Score = 73.2 bits (178), Expect = 2e-11 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -2 Query: 296 IKHDVTDVQCLMPGLILAIRKVVRLKNLVYGLEKFL 189 IKHD+TDVQCLMPGL+LAIRKVVRLKNLVYGLEKFL Sbjct: 267 IKHDITDVQCLMPGLLLAIRKVVRLKNLVYGLEKFL 302 >emb|CBI31836.3| unnamed protein product [Vitis vinifera] Length = 303 Score = 71.6 bits (174), Expect = 6e-11 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -2 Query: 296 IKHDVTDVQCLMPGLILAIRKVVRLKNLVYGLEKFL 189 +KHD+TDV+CLMPGLILAIRKVVRLKNLVYGLEKFL Sbjct: 268 LKHDITDVRCLMPGLILAIRKVVRLKNLVYGLEKFL 303 >ref|XP_002274702.1| PREDICTED: putative dihydrodipicolinate reductase 3, chloroplastic [Vitis vinifera] gi|147816661|emb|CAN68386.1| hypothetical protein VITISV_012454 [Vitis vinifera] Length = 302 Score = 71.6 bits (174), Expect = 6e-11 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -2 Query: 296 IKHDVTDVQCLMPGLILAIRKVVRLKNLVYGLEKFL 189 +KHD+TDV+CLMPGLILAIRKVVRLKNLVYGLEKFL Sbjct: 267 LKHDITDVRCLMPGLILAIRKVVRLKNLVYGLEKFL 302 >ref|XP_003556086.1| PREDICTED: putative dihydrodipicolinate reductase 3, chloroplastic-like [Glycine max] Length = 301 Score = 70.9 bits (172), Expect = 1e-10 Identities = 32/36 (88%), Positives = 36/36 (100%) Frame = -2 Query: 296 IKHDVTDVQCLMPGLILAIRKVVRLKNLVYGLEKFL 189 IKHD+TDV+CLMPGL+LAIRKVVRLKNLVYGLEKF+ Sbjct: 266 IKHDITDVKCLMPGLLLAIRKVVRLKNLVYGLEKFI 301 >ref|XP_003536480.1| PREDICTED: putative dihydrodipicolinate reductase 3, chloroplastic-like [Glycine max] Length = 301 Score = 70.9 bits (172), Expect = 1e-10 Identities = 32/36 (88%), Positives = 36/36 (100%) Frame = -2 Query: 296 IKHDVTDVQCLMPGLILAIRKVVRLKNLVYGLEKFL 189 IKHD+TDV+CLMPGL+LAIRKVVRLKNLVYGLEKF+ Sbjct: 266 IKHDITDVKCLMPGLLLAIRKVVRLKNLVYGLEKFI 301