BLASTX nr result
ID: Bupleurum21_contig00017570
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00017570 (438 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004169415.1| PREDICTED: two-component response regulator-... 63 2e-08 ref|XP_004142221.1| PREDICTED: two-component response regulator-... 63 2e-08 ref|XP_003541399.1| PREDICTED: two-component response regulator-... 60 2e-07 ref|XP_002525199.1| sensory transduction histidine kinase, putat... 60 2e-07 ref|XP_002525050.1| Two-component response regulator ARR2, putat... 59 4e-07 >ref|XP_004169415.1| PREDICTED: two-component response regulator-like APRR7-like [Cucumis sativus] Length = 794 Score = 63.2 bits (152), Expect = 2e-08 Identities = 37/71 (52%), Positives = 44/71 (61%) Frame = -3 Query: 226 YAKTFNSNIEAFEDSKTEPETELNLKRLRGSKDTGKANQTDRNVLRRTDLSAFSSSKRYN 47 + KT + + DS+ P EL LKRLRG + TGKA Q +RNVLRR+D SAFS RYN Sbjct: 427 HPKTTDIKNKDVTDSEDFPSLELGLKRLRGVQKTGKAVQDERNVLRRSDSSAFS---RYN 483 Query: 46 ITSNGIKVPNG 14 SN K P G Sbjct: 484 AGSNSNKTPTG 494 >ref|XP_004142221.1| PREDICTED: two-component response regulator-like APRR7-like [Cucumis sativus] Length = 797 Score = 63.2 bits (152), Expect = 2e-08 Identities = 37/71 (52%), Positives = 44/71 (61%) Frame = -3 Query: 226 YAKTFNSNIEAFEDSKTEPETELNLKRLRGSKDTGKANQTDRNVLRRTDLSAFSSSKRYN 47 + KT + + DS+ P EL LKRLRG + TGKA Q +RNVLRR+D SAFS RYN Sbjct: 427 HPKTTDIKNKDVTDSEDFPSLELGLKRLRGVQKTGKAVQDERNVLRRSDSSAFS---RYN 483 Query: 46 ITSNGIKVPNG 14 SN K P G Sbjct: 484 AGSNSNKTPTG 494 >ref|XP_003541399.1| PREDICTED: two-component response regulator-like APRR7-like [Glycine max] Length = 749 Score = 60.1 bits (144), Expect = 2e-07 Identities = 38/73 (52%), Positives = 45/73 (61%), Gaps = 2/73 (2%) Frame = -3 Query: 226 YAKTFNSNIEAFEDSKTE--PETELNLKRLRGSKDTGKANQTDRNVLRRTDLSAFSSSKR 53 Y K +S+IE + + E P EL+LKRLRG +D G A Q DRNVLRR+D SAFS R Sbjct: 386 YKKPKSSDIENKDTNNDEELPSLELSLKRLRGVEDAGIAIQDDRNVLRRSDQSAFS---R 442 Query: 52 YNITSNGIKVPNG 14 YN N K P G Sbjct: 443 YNAALNPKKSPTG 455 >ref|XP_002525199.1| sensory transduction histidine kinase, putative [Ricinus communis] gi|223535496|gb|EEF37165.1| sensory transduction histidine kinase, putative [Ricinus communis] Length = 762 Score = 59.7 bits (143), Expect = 2e-07 Identities = 33/56 (58%), Positives = 38/56 (67%) Frame = -3 Query: 187 DSKTEPETELNLKRLRGSKDTGKANQTDRNVLRRTDLSAFSSSKRYNITSNGIKVP 20 D+K P EL+LKR RG+KD G Q DRNVLRR+D SAFS RYN +SN K P Sbjct: 436 DAKEIPTFELSLKRNRGAKDVGTVVQEDRNVLRRSDSSAFS---RYNASSNAKKAP 488 >ref|XP_002525050.1| Two-component response regulator ARR2, putative [Ricinus communis] gi|223535631|gb|EEF37297.1| Two-component response regulator ARR2, putative [Ricinus communis] Length = 659 Score = 58.9 bits (141), Expect = 4e-07 Identities = 39/84 (46%), Positives = 44/84 (52%) Frame = -3 Query: 265 ITKTPPPQMVIEDYAKTFNSNIEAFEDSKTEPETELNLKRLRGSKDTGKANQTDRNVLRR 86 IT V+ D K N N E +SK P EL+LKRLR DTG DRNVLR Sbjct: 291 ITTNSADPSVVFDVPKASNQNDEVAHESKGIPCLELSLKRLRDVGDTG-TRAKDRNVLRH 349 Query: 85 TDLSAFSSSKRYNITSNGIKVPNG 14 +DLSAFS RYN S + P G Sbjct: 350 SDLSAFS---RYNSASTANQAPTG 370