BLASTX nr result
ID: Bupleurum21_contig00016902
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00016902 (318 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514872.1| conserved hypothetical protein [Ricinus comm... 63 2e-08 >ref|XP_002514872.1| conserved hypothetical protein [Ricinus communis] gi|223545923|gb|EEF47426.1| conserved hypothetical protein [Ricinus communis] Length = 1590 Score = 63.2 bits (152), Expect = 2e-08 Identities = 40/104 (38%), Positives = 60/104 (57%), Gaps = 2/104 (1%) Frame = +3 Query: 3 FNLMSDREPDMHHSLALGSYGSNIGGPLHNSVIDEQVVVPTTTEKLLPRSSSGALTDESP 182 F ++SD+E +++S A+GSYGSN S EQ TEKL RS SGA + Sbjct: 1276 FGVVSDQEASLNNSFAIGSYGSNACEVAEISSAGEQGNNFGGTEKLPFRSESGATYERHS 1335 Query: 183 YLSGKKENSQAIYTNANMVGKLSAD--FLDLEEKLHGLKNEGGT 308 L G EN QA+ + + + KLSA+ ++D+E + +G K++G T Sbjct: 1336 SLLGISENPQAVLNDLSFIEKLSANRGYMDVEGRKYGAKSQGMT 1379