BLASTX nr result
ID: Bupleurum21_contig00016656
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00016656 (314 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003591521.1| UDP-glucuronic acid decarboxylase [Medicago ... 105 4e-21 ref|XP_002268787.1| PREDICTED: UDP-glucuronic acid decarboxylase... 104 8e-21 ref|XP_003519763.1| PREDICTED: UDP-glucuronic acid decarboxylase... 102 4e-20 ref|XP_003536125.1| PREDICTED: UDP-glucuronic acid decarboxylase... 100 1e-19 ref|XP_002321005.1| predicted protein [Populus trichocarpa] gi|1... 98 8e-19 >ref|XP_003591521.1| UDP-glucuronic acid decarboxylase [Medicago truncatula] gi|355480569|gb|AES61772.1| UDP-glucuronic acid decarboxylase [Medicago truncatula] Length = 430 Score = 105 bits (262), Expect = 4e-21 Identities = 47/62 (75%), Positives = 56/62 (90%) Frame = -1 Query: 188 MASELIFRGHETQPTTDTYSPKPNKPWLSVIRPIRYILREQRLLFIVVGIVIATVFFALL 9 M+SEL FRGHETQ D YSPKPNKPWLSVIRPIRY+LREQRL+F+++GIVIA+VFF ++ Sbjct: 1 MSSELTFRGHETQQVNDEYSPKPNKPWLSVIRPIRYMLREQRLVFVLIGIVIASVFFTII 60 Query: 8 PS 3 PS Sbjct: 61 PS 62 >ref|XP_002268787.1| PREDICTED: UDP-glucuronic acid decarboxylase 1-like [Vitis vinifera] Length = 444 Score = 104 bits (259), Expect = 8e-21 Identities = 50/62 (80%), Positives = 53/62 (85%) Frame = -1 Query: 188 MASELIFRGHETQPTTDTYSPKPNKPWLSVIRPIRYILREQRLLFIVVGIVIATVFFALL 9 M SELIFRGHETQP D YSPKP KPWLSV+RPIRY+LREQRLLF +VGI IATV F LL Sbjct: 1 MGSELIFRGHETQPMADGYSPKPPKPWLSVVRPIRYMLREQRLLFTLVGIAIATVVFLLL 60 Query: 8 PS 3 PS Sbjct: 61 PS 62 >ref|XP_003519763.1| PREDICTED: UDP-glucuronic acid decarboxylase 1-like [Glycine max] Length = 389 Score = 102 bits (253), Expect = 4e-20 Identities = 44/62 (70%), Positives = 54/62 (87%) Frame = -1 Query: 188 MASELIFRGHETQPTTDTYSPKPNKPWLSVIRPIRYILREQRLLFIVVGIVIATVFFALL 9 M SELIFRGHETQP D YSPKP+KPWL+V RPI Y+LREQRLLF+++G++IAT+FF + Sbjct: 1 MGSELIFRGHETQPVDDAYSPKPHKPWLTVTRPIHYMLREQRLLFVLLGVIIATLFFTFV 60 Query: 8 PS 3 PS Sbjct: 61 PS 62 >ref|XP_003536125.1| PREDICTED: UDP-glucuronic acid decarboxylase 1-like [Glycine max] Length = 427 Score = 100 bits (249), Expect = 1e-19 Identities = 43/62 (69%), Positives = 54/62 (87%) Frame = -1 Query: 188 MASELIFRGHETQPTTDTYSPKPNKPWLSVIRPIRYILREQRLLFIVVGIVIATVFFALL 9 M SELIFRGHE QP D+YSPKP+KPW +V RPI Y+LREQRL+F++VG++IAT+FF L+ Sbjct: 1 MGSELIFRGHEAQPVDDSYSPKPHKPWFTVTRPIHYMLREQRLVFVLVGVIIATLFFTLV 60 Query: 8 PS 3 PS Sbjct: 61 PS 62 >ref|XP_002321005.1| predicted protein [Populus trichocarpa] gi|118484863|gb|ABK94298.1| unknown [Populus trichocarpa] gi|222861778|gb|EEE99320.1| predicted protein [Populus trichocarpa] Length = 442 Score = 97.8 bits (242), Expect = 8e-19 Identities = 46/62 (74%), Positives = 54/62 (87%), Gaps = 1/62 (1%) Frame = -1 Query: 185 ASELIFRGH-ETQPTTDTYSPKPNKPWLSVIRPIRYILREQRLLFIVVGIVIATVFFALL 9 +SELIFRGH ETQPT D YSPKP KPWL VIRP+RY+LRE+RL+F +VG+ IATVFF +L Sbjct: 3 SSELIFRGHDETQPTPDAYSPKPAKPWLFVIRPVRYLLREKRLVFFLVGMAIATVFFTIL 62 Query: 8 PS 3 PS Sbjct: 63 PS 64