BLASTX nr result
ID: Bupleurum21_contig00016534
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00016534 (501 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002320393.1| predicted protein [Populus trichocarpa] gi|2... 75 5e-12 ref|XP_002516785.1| conserved hypothetical protein [Ricinus comm... 60 2e-07 >ref|XP_002320393.1| predicted protein [Populus trichocarpa] gi|222861166|gb|EEE98708.1| predicted protein [Populus trichocarpa] Length = 64 Score = 75.1 bits (183), Expect = 5e-12 Identities = 31/48 (64%), Positives = 42/48 (87%) Frame = -1 Query: 414 KVQMAANSLSIGCSKIRSWQRCSKRVRQQRGRLYIIWRCTVLLMNWQE 271 K+QMAA++LS+ K+RSWQRCSK++R+QR RLYIIWRCTV+L+ W + Sbjct: 17 KIQMAADALSMRSMKLRSWQRCSKQIREQRTRLYIIWRCTVMLLCWHD 64 >ref|XP_002516785.1| conserved hypothetical protein [Ricinus communis] gi|223543873|gb|EEF45399.1| conserved hypothetical protein [Ricinus communis] Length = 66 Score = 60.1 bits (144), Expect = 2e-07 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = -1 Query: 372 KIRSWQRCSKRVRQQRGRLYIIWRCTVLLMNWQE 271 K RSWQRCS+ V++QR RLYIIWRCTV+L++W + Sbjct: 13 KFRSWQRCSRLVKEQRTRLYIIWRCTVILLSWDD 46