BLASTX nr result
ID: Bupleurum21_contig00015777
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00015777 (294 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EFW46065.1| coatomer subunit gamma-2 [Capsaspora owczarzaki A... 47 2e-10 gb|EGG23667.1| adaptin N-terminal domain-containing protein [Dic... 48 2e-10 gb|EFA81100.1| adaptin N-terminal domain-containing protein [Pol... 50 3e-10 ref|NP_593371.1| coatomer gamma subunit Sec21 (predicted) [Schiz... 46 1e-09 ref|XP_636291.1| adaptin N-terminal domain-containing protein [D... 46 3e-09 >gb|EFW46065.1| coatomer subunit gamma-2 [Capsaspora owczarzaki ATCC 30864] Length = 896 Score = 46.6 bits (109), Expect(2) = 2e-10 Identities = 22/35 (62%), Positives = 29/35 (82%) Frame = +2 Query: 179 MVTLFPYIMSDIADEFKIVVVEAIRPLCLKFPLKY 283 M + P+ MS+I+DEFKIVV++AIR LCLKFP K+ Sbjct: 355 MTQITPF-MSEISDEFKIVVIDAIRTLCLKFPQKH 388 Score = 43.1 bits (100), Expect(2) = 2e-10 Identities = 20/34 (58%), Positives = 28/34 (82%) Frame = +3 Query: 6 PAITVLQLFLSSSKPVFRFAAVRTLNKVALSEPT 107 PA++V+QLFL++ K + RFAAVRTL++VA PT Sbjct: 281 PALSVMQLFLTAPKSIMRFAAVRTLSQVANRYPT 314 >gb|EGG23667.1| adaptin N-terminal domain-containing protein [Dictyostelium fasciculatum] Length = 890 Score = 47.8 bits (112), Expect(2) = 2e-10 Identities = 24/34 (70%), Positives = 26/34 (76%) Frame = +3 Query: 3 TPAITVLQLFLSSSKPVFRFAAVRTLNKVALSEP 104 T A+ LQLFLSSSKP RFAAVRTLNK+A P Sbjct: 284 TSAVGTLQLFLSSSKPTLRFAAVRTLNKLAQVNP 317 Score = 42.0 bits (97), Expect(2) = 2e-10 Identities = 20/42 (47%), Positives = 27/42 (64%) Frame = +2 Query: 167 NLS*MVTLFPYIMSDIADEFKIVVVEAIRPLCLKFPLKYRSL 292 N+ ++ + DI DEFKIVVVE+I L +KFP KY+ L Sbjct: 354 NVERLIKQISNFLDDINDEFKIVVVESITALSIKFPKKYKQL 395 >gb|EFA81100.1| adaptin N-terminal domain-containing protein [Polysphondylium pallidum PN500] Length = 887 Score = 50.1 bits (118), Expect(2) = 3e-10 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = +3 Query: 3 TPAITVLQLFLSSSKPVFRFAAVRTLNKVALSEP 104 T A+ +LQLFLSSSKP RFAAVRTLNK+A + P Sbjct: 282 TSAVGILQLFLSSSKPTLRFAAVRTLNKLAQTNP 315 Score = 39.3 bits (90), Expect(2) = 3e-10 Identities = 19/42 (45%), Positives = 27/42 (64%) Frame = +2 Query: 167 NLS*MVTLFPYIMSDIADEFKIVVVEAIRPLCLKFPLKYRSL 292 N+ ++ + DI DEFKIVVVE+I L +KFP K++ L Sbjct: 352 NVERLIKQISNFLGDINDEFKIVVVESITMLSVKFPKKFKHL 393 >ref|NP_593371.1| coatomer gamma subunit Sec21 (predicted) [Schizosaccharomyces pombe 972h-] gi|3182972|sp|P87140.1|COPG_SCHPO RecName: Full=Probable coatomer subunit gamma; AltName: Full=Gamma-coat protein; Short=Gamma-COP gi|2104445|emb|CAB08768.1| coatomer gamma subunit Sec21 (predicted) [Schizosaccharomyces pombe] Length = 905 Score = 45.8 bits (107), Expect(2) = 1e-09 Identities = 21/30 (70%), Positives = 25/30 (83%) Frame = +2 Query: 203 MSDIADEFKIVVVEAIRPLCLKFPLKYRSL 292 MSDI+D FKI+VV+AIR LCLKFP K S+ Sbjct: 388 MSDISDNFKIIVVDAIRSLCLKFPRKQDSM 417 Score = 41.2 bits (95), Expect(2) = 1e-09 Identities = 18/47 (38%), Positives = 32/47 (68%) Frame = +3 Query: 6 PAITVLQLFLSSSKPVFRFAAVRTLNKVALSEPTH*HCLLFNTVTIL 146 P ++VL++FLSS + RF+A+RTLN++A++ P H N +++ Sbjct: 307 PVVSVLKIFLSSHRSATRFSAIRTLNELAMTRPHLVHSCNLNIESLI 353 >ref|XP_636291.1| adaptin N-terminal domain-containing protein [Dictyostelium discoideum AX4] gi|74852243|sp|Q54HL0.1|COPG_DICDI RecName: Full=Coatomer subunit gamma; AltName: Full=Gamma-coat protein; Short=Gamma-COP gi|60464638|gb|EAL62772.1| adaptin N-terminal domain-containing protein [Dictyostelium discoideum AX4] Length = 898 Score = 45.8 bits (107), Expect(2) = 3e-09 Identities = 22/33 (66%), Positives = 27/33 (81%) Frame = +3 Query: 9 AITVLQLFLSSSKPVFRFAAVRTLNKVALSEPT 107 A+ VLQ FL+S+KP RFAAVRTLNK+A + PT Sbjct: 285 AVGVLQNFLNSTKPTLRFAAVRTLNKLAQTNPT 317 Score = 40.0 bits (92), Expect(2) = 3e-09 Identities = 20/42 (47%), Positives = 26/42 (61%) Frame = +2 Query: 167 NLS*MVTLFPYIMSDIADEFKIVVVEAIRPLCLKFPLKYRSL 292 N+ ++ + DI DEFKIVVV+AI L KFP KY+ L Sbjct: 353 NVERLIKQIANFLGDINDEFKIVVVDAITSLSQKFPKKYKHL 394