BLASTX nr result
ID: Bupleurum21_contig00015646
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00015646 (597 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_192801.1| Glutaredoxin family protein [Arabidopsis thalia... 70 3e-10 >ref|NP_192801.1| Glutaredoxin family protein [Arabidopsis thaliana] gi|4115916|gb|AAD03427.1| F3H7.9 gene product [Arabidopsis thaliana] gi|4539441|emb|CAB40029.1| putative protein [Arabidopsis thaliana] gi|7267760|emb|CAB78186.1| putative protein [Arabidopsis thaliana] gi|332657511|gb|AEE82911.1| Glutaredoxin family protein [Arabidopsis thaliana] Length = 334 Score = 70.1 bits (170), Expect = 3e-10 Identities = 64/204 (31%), Positives = 85/204 (41%), Gaps = 30/204 (14%) Frame = -1 Query: 522 MGCVSSTLLNENDELAQMG-----IGHHIVSLTSTTYGXXXXXXXXXXXXXXXXXXXXPK 358 MGCVSS LLN +++ +Q+G GHHIV LTSTTYG Sbjct: 1 MGCVSSNLLNHDEDFSQIGGGSSAFGHHIVKLTSTTYGLLTLDPPPPP------------ 48 Query: 357 SNTISHSKTASEETNVYADINSTSSPIVTKILKYDAPEVINSWELMEGLVENDSTNTSSF 178 S T E+ V D S S +++K + PE+INSWELM GL + SF Sbjct: 49 ----SPPMTPPEKFTV--DTKSKSIWSEPRVIKSE-PEIINSWELMSGL------DGESF 95 Query: 177 RFSTLPPT---------------QPSKRVPLRD-----LEXXXXXXXXXXXXXXXXXXLY 58 RF+ LP T PS+R P ++ L+ + Sbjct: 96 RFTPLPKTPVKYKVFGGENKENSDPSRRNPRKNLNDEVLKPLDLNREDSDSNSRSPRKSF 155 Query: 57 YPHD-----AFEKLCPPNGGNQQV 1 P D FE++CPP G N+ V Sbjct: 156 KPLDLKLDEKFERICPPGGENRVV 179