BLASTX nr result
ID: Bupleurum21_contig00015615
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00015615 (437 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEZ56957.1| boron transporter [Vitis vinifera] 61 8e-08 ref|XP_002282501.1| PREDICTED: probable boron transporter 2 [Vit... 59 5e-07 >gb|AEZ56957.1| boron transporter [Vitis vinifera] Length = 720 Score = 61.2 bits (147), Expect = 8e-08 Identities = 32/58 (55%), Positives = 41/58 (70%), Gaps = 3/58 (5%) Frame = +1 Query: 4 DLKAAYNSPGSQEAYSPRMNDLK---SIELNVQGTEIRKTPSPGPSILGQSSHGSPSS 168 D+K AY+ SQ AYSPR+N+L+ S L +G E+ +TPSP PSILG+S HGS SS Sbjct: 663 DMKPAYSPRLSQRAYSPRLNELRAEQSPRLTGKGVELNETPSPRPSILGKSPHGSSSS 720 >ref|XP_002282501.1| PREDICTED: probable boron transporter 2 [Vitis vinifera] gi|297733771|emb|CBI15018.3| unnamed protein product [Vitis vinifera] Length = 720 Score = 58.5 bits (140), Expect = 5e-07 Identities = 30/58 (51%), Positives = 41/58 (70%), Gaps = 3/58 (5%) Frame = +1 Query: 4 DLKAAYNSPGSQEAYSPRMNDLK---SIELNVQGTEIRKTPSPGPSILGQSSHGSPSS 168 D+K AY+ SQ AYSPR+++L+ S +G E+++TPSP PSILG+S HGS SS Sbjct: 663 DMKPAYSPRLSQRAYSPRLSELRAEQSPRFTGKGVELKETPSPRPSILGKSPHGSSSS 720