BLASTX nr result
ID: Bupleurum21_contig00015005
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00015005 (274 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003533074.1| PREDICTED: uncharacterized protein LOC100805... 59 5e-07 ref|XP_002530460.1| transcription cofactor, putative [Ricinus co... 55 5e-06 ref|XP_003597955.1| hypothetical protein MTR_2g104400 [Medicago ... 55 8e-06 gb|AAN62354.1|AF506028_23 CTV.22 [Citrus trifoliata] 55 8e-06 >ref|XP_003533074.1| PREDICTED: uncharacterized protein LOC100805336 [Glycine max] Length = 1304 Score = 58.5 bits (140), Expect = 5e-07 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = -3 Query: 131 MQSNQSPQLHQMSDSADLKMRQQLSVKSGAFQQHHSPGQRSAY 3 +Q++Q PQLHQM+D D+KMRQ + VKSG FQQH + GQ S Y Sbjct: 829 LQTHQMPQLHQMNDINDIKMRQGMGVKSGVFQQHLTSGQHSTY 871 >ref|XP_002530460.1| transcription cofactor, putative [Ricinus communis] gi|223530005|gb|EEF31930.1| transcription cofactor, putative [Ricinus communis] Length = 1382 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/43 (58%), Positives = 32/43 (74%) Frame = -3 Query: 131 MQSNQSPQLHQMSDSADLKMRQQLSVKSGAFQQHHSPGQRSAY 3 MQ++Q PQ+HQM+D DLK+R + VK G FQQH S GQR+ Y Sbjct: 907 MQAHQMPQVHQMNDVNDLKIRPGMGVKPGVFQQHLSAGQRTTY 949 >ref|XP_003597955.1| hypothetical protein MTR_2g104400 [Medicago truncatula] gi|355487003|gb|AES68206.1| hypothetical protein MTR_2g104400 [Medicago truncatula] Length = 1289 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/43 (58%), Positives = 32/43 (74%) Frame = -3 Query: 131 MQSNQSPQLHQMSDSADLKMRQQLSVKSGAFQQHHSPGQRSAY 3 MQ++Q QLHQM+D D+KMRQ ++ K G FQQH + QRSAY Sbjct: 817 MQTHQMQQLHQMNDVNDMKMRQGINAKPGVFQQHLASSQRSAY 859 >gb|AAN62354.1|AF506028_23 CTV.22 [Citrus trifoliata] Length = 1405 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/43 (58%), Positives = 34/43 (79%) Frame = -3 Query: 131 MQSNQSPQLHQMSDSADLKMRQQLSVKSGAFQQHHSPGQRSAY 3 + ++Q PQL+QM+D DLK+RQ ++VK G FQQH + GQRSAY Sbjct: 930 LPTHQMPQLNQMNDVNDLKIRQGMAVKPGVFQQHLTSGQRSAY 972