BLASTX nr result
ID: Bupleurum21_contig00014335
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00014335 (374 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004157035.1| PREDICTED: novel plant SNARE 13-like [Cucumi... 83 3e-14 ref|XP_004138520.1| PREDICTED: novel plant SNARE 13-like [Cucumi... 83 3e-14 ref|XP_002267688.1| PREDICTED: novel plant SNARE 13 [Vitis vinif... 83 3e-14 gb|AFK41494.1| unknown [Lotus japonicus] 81 8e-14 emb|CAN79626.1| hypothetical protein VITISV_025953 [Vitis vinifera] 81 1e-13 >ref|XP_004157035.1| PREDICTED: novel plant SNARE 13-like [Cucumis sativus] Length = 268 Score = 82.8 bits (203), Expect = 3e-14 Identities = 40/49 (81%), Positives = 45/49 (91%) Frame = -3 Query: 372 FLFLIVCGVIAVIIVKIVNPHNKNIRDIPGLAPPAPTARRLLYLKSGQY 226 FLFLIVCGVIA+I+VKIVNP+NKNIRDIPGLAPP P ARRLLYL++ Y Sbjct: 219 FLFLIVCGVIAIIVVKIVNPNNKNIRDIPGLAPPVP-ARRLLYLRTTDY 266 >ref|XP_004138520.1| PREDICTED: novel plant SNARE 13-like [Cucumis sativus] Length = 268 Score = 82.8 bits (203), Expect = 3e-14 Identities = 40/49 (81%), Positives = 45/49 (91%) Frame = -3 Query: 372 FLFLIVCGVIAVIIVKIVNPHNKNIRDIPGLAPPAPTARRLLYLKSGQY 226 FLFLIVCGVIA+I+VKIVNP+NKNIRDIPGLAPP P ARRLLYL++ Y Sbjct: 219 FLFLIVCGVIAIIVVKIVNPNNKNIRDIPGLAPPVP-ARRLLYLRTTDY 266 >ref|XP_002267688.1| PREDICTED: novel plant SNARE 13 [Vitis vinifera] gi|297736807|emb|CBI26008.3| unnamed protein product [Vitis vinifera] Length = 269 Score = 82.8 bits (203), Expect = 3e-14 Identities = 39/50 (78%), Positives = 47/50 (94%) Frame = -3 Query: 372 FLFLIVCGVIAVIIVKIVNPHNKNIRDIPGLAPPAPTARRLLYLKSGQYI 223 FLFLIVCGVIA+IIVKIVNP+NK+I+D+PGLAPPAP +RRLLYLK+ Y+ Sbjct: 220 FLFLIVCGVIAIIIVKIVNPNNKSIKDVPGLAPPAP-SRRLLYLKASDYL 268 >gb|AFK41494.1| unknown [Lotus japonicus] Length = 269 Score = 81.3 bits (199), Expect = 8e-14 Identities = 37/48 (77%), Positives = 47/48 (97%) Frame = -3 Query: 372 FLFLIVCGVIAVIIVKIVNPHNKNIRDIPGLAPPAPTARRLLYLKSGQ 229 FLFLIVCGV+A+I+VKIVNP+NK+I+DIPGLAPPAPT RRLLY+++G+ Sbjct: 220 FLFLIVCGVVAIIVVKIVNPNNKDIKDIPGLAPPAPT-RRLLYVRTGE 266 >emb|CAN79626.1| hypothetical protein VITISV_025953 [Vitis vinifera] Length = 87 Score = 80.9 bits (198), Expect = 1e-13 Identities = 38/50 (76%), Positives = 46/50 (92%) Frame = -3 Query: 372 FLFLIVCGVIAVIIVKIVNPHNKNIRDIPGLAPPAPTARRLLYLKSGQYI 223 FLFLIVCGVIA+IIVKIVNP+NK+I+D+PGLAPPAP +RRLLY K+ Y+ Sbjct: 38 FLFLIVCGVIAIIIVKIVNPNNKSIKDVPGLAPPAP-SRRLLYXKASDYL 86