BLASTX nr result
ID: Bupleurum21_contig00014276
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00014276 (560 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN73734.1| hypothetical protein VITISV_032119 [Vitis vinifera] 42 4e-08 >emb|CAN73734.1| hypothetical protein VITISV_032119 [Vitis vinifera] Length = 917 Score = 42.4 bits (98), Expect(3) = 4e-08 Identities = 21/39 (53%), Positives = 24/39 (61%) Frame = -1 Query: 137 DIVDTSIVYTCNDGYQKYWVK*YD*SWSDCTWIFDVEFK 21 D++D IV T GYQKY VK SDCTWI D EF+ Sbjct: 675 DVIDHQIVSTRGGGYQKYLVKWRGKPLSDCTWITDGEFQ 713 Score = 34.7 bits (78), Expect(3) = 4e-08 Identities = 19/41 (46%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -2 Query: 253 MGINNIFNIEHLTIYHGHVDSSKSIAP-TRHPPAPNIHDKI 134 MGI+NIFNIE LT+ D + P R PPAP + ++I Sbjct: 633 MGISNIFNIEDLTLCSNPEDVITNGGPNARLPPAPRLKEEI 673 Score = 24.6 bits (52), Expect(3) = 4e-08 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -3 Query: 324 GDRVMVRVKP*SFPNGKYNK 265 GD +MVR++ +P G Y K Sbjct: 586 GDMIMVRIRLERYPKGTYKK 605