BLASTX nr result
ID: Bupleurum21_contig00014035
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00014035 (490 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003625285.1| Thioredoxin-like protein [Medicago truncatul... 173 1e-41 ref|XP_002322732.1| predicted protein [Populus trichocarpa] gi|2... 173 1e-41 gb|AFH68079.1| thioredoxin-like protein 2.1 [Populus tremula x P... 172 3e-41 gb|AFK34102.1| unknown [Lotus japonicus] 169 2e-40 ref|XP_004146393.1| PREDICTED: thioredoxin-like 3-1, chloroplast... 167 8e-40 >ref|XP_003625285.1| Thioredoxin-like protein [Medicago truncatula] gi|355500300|gb|AES81503.1| Thioredoxin-like protein [Medicago truncatula] Length = 187 Score = 173 bits (439), Expect = 1e-41 Identities = 78/88 (88%), Positives = 84/88 (95%) Frame = -3 Query: 488 IDWMASWCRKCIYLKPKLEKLAAEFDTKLKFYYVDVNKVPQALVKRGNVSKMPTIQLWKD 309 IDWMA+WCRKCIYLKPKLEKLAAEFDTK KFYYVDVNKVPQ LVKRG +SKMPTIQLWKD Sbjct: 100 IDWMAAWCRKCIYLKPKLEKLAAEFDTKAKFYYVDVNKVPQTLVKRGKISKMPTIQLWKD 159 Query: 308 GEMKEEVIGGHKAWLVLEEVREMIKNFV 225 GEMKEEVIGGHK WLV+EEVREMI+N++ Sbjct: 160 GEMKEEVIGGHKGWLVIEEVREMIQNYI 187 >ref|XP_002322732.1| predicted protein [Populus trichocarpa] gi|222867362|gb|EEF04493.1| predicted protein [Populus trichocarpa] Length = 194 Score = 173 bits (439), Expect = 1e-41 Identities = 80/88 (90%), Positives = 85/88 (96%) Frame = -3 Query: 488 IDWMASWCRKCIYLKPKLEKLAAEFDTKLKFYYVDVNKVPQALVKRGNVSKMPTIQLWKD 309 IDWMASWCRKCIYLKPKLEKLAAE+DTK+KFY VDVNKVPQALVKRGN+SKMPTIQLWKD Sbjct: 107 IDWMASWCRKCIYLKPKLEKLAAEYDTKIKFYCVDVNKVPQALVKRGNISKMPTIQLWKD 166 Query: 308 GEMKEEVIGGHKAWLVLEEVREMIKNFV 225 GEMK EVIGGHKAWLV+EEVREMI+ FV Sbjct: 167 GEMKAEVIGGHKAWLVMEEVREMIQKFV 194 >gb|AFH68079.1| thioredoxin-like protein 2.1 [Populus tremula x Populus tremuloides] Length = 121 Score = 172 bits (435), Expect = 3e-41 Identities = 79/88 (89%), Positives = 84/88 (95%) Frame = -3 Query: 488 IDWMASWCRKCIYLKPKLEKLAAEFDTKLKFYYVDVNKVPQALVKRGNVSKMPTIQLWKD 309 IDWMASWCRKCIYLKPKLEKLAAE+DTK+KFY DVNKVPQALVKRGN+SKMPTIQLWKD Sbjct: 34 IDWMASWCRKCIYLKPKLEKLAAEYDTKIKFYCADVNKVPQALVKRGNISKMPTIQLWKD 93 Query: 308 GEMKEEVIGGHKAWLVLEEVREMIKNFV 225 GEMK EVIGGHKAWLV+EEVREMI+ FV Sbjct: 94 GEMKAEVIGGHKAWLVIEEVREMIQKFV 121 >gb|AFK34102.1| unknown [Lotus japonicus] Length = 187 Score = 169 bits (429), Expect = 2e-40 Identities = 77/88 (87%), Positives = 83/88 (94%) Frame = -3 Query: 488 IDWMASWCRKCIYLKPKLEKLAAEFDTKLKFYYVDVNKVPQALVKRGNVSKMPTIQLWKD 309 IDWMASWCRKCIYL+PKLEKLAAEFDTK+ FY VDVNKVPQ LVKRGN+SKMPTIQLWKD Sbjct: 100 IDWMASWCRKCIYLQPKLEKLAAEFDTKVSFYCVDVNKVPQTLVKRGNISKMPTIQLWKD 159 Query: 308 GEMKEEVIGGHKAWLVLEEVREMIKNFV 225 GEMKEEVIGGHK WLV+EEVREMI+ F+ Sbjct: 160 GEMKEEVIGGHKGWLVIEEVREMIQKFI 187 >ref|XP_004146393.1| PREDICTED: thioredoxin-like 3-1, chloroplastic-like [Cucumis sativus] Length = 176 Score = 167 bits (423), Expect = 8e-40 Identities = 76/87 (87%), Positives = 83/87 (95%) Frame = -3 Query: 488 IDWMASWCRKCIYLKPKLEKLAAEFDTKLKFYYVDVNKVPQALVKRGNVSKMPTIQLWKD 309 IDWMA+WCRKCIYLKPKLEKLAA++ TK KFYYVDVNKVPQ+LVKRGN+SKMPTIQLWKD Sbjct: 88 IDWMATWCRKCIYLKPKLEKLAADYVTKAKFYYVDVNKVPQSLVKRGNISKMPTIQLWKD 147 Query: 308 GEMKEEVIGGHKAWLVLEEVREMIKNF 228 GEMK EVIGGHKAWLV+EEVREMI+ F Sbjct: 148 GEMKAEVIGGHKAWLVIEEVREMIQKF 174