BLASTX nr result
ID: Bupleurum21_contig00013446
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00013446 (399 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004169455.1| PREDICTED: LOW QUALITY PROTEIN: ATP-citrate ... 108 5e-22 ref|XP_004148805.1| PREDICTED: ATP-citrate synthase beta chain p... 108 5e-22 gb|AFW80634.1| hypothetical protein ZEAMMB73_758959 [Zea mays] 108 5e-22 gb|AFO64345.1| putative ATP citrate lyase [Saccharum hybrid cult... 108 5e-22 ref|XP_003546316.1| PREDICTED: ATP-citrate synthase beta chain p... 108 5e-22 >ref|XP_004169455.1| PREDICTED: LOW QUALITY PROTEIN: ATP-citrate synthase beta chain protein 1-like [Cucumis sativus] Length = 609 Score = 108 bits (270), Expect = 5e-22 Identities = 51/51 (100%), Positives = 51/51 (100%) Frame = +3 Query: 3 KQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 155 KQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 559 KQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 609 >ref|XP_004148805.1| PREDICTED: ATP-citrate synthase beta chain protein 1-like [Cucumis sativus] Length = 608 Score = 108 bits (270), Expect = 5e-22 Identities = 51/51 (100%), Positives = 51/51 (100%) Frame = +3 Query: 3 KQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 155 KQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 558 KQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 608 >gb|AFW80634.1| hypothetical protein ZEAMMB73_758959 [Zea mays] Length = 449 Score = 108 bits (270), Expect = 5e-22 Identities = 51/51 (100%), Positives = 51/51 (100%) Frame = +3 Query: 3 KQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 155 KQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 399 KQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 449 >gb|AFO64345.1| putative ATP citrate lyase [Saccharum hybrid cultivar GT28] Length = 608 Score = 108 bits (270), Expect = 5e-22 Identities = 51/51 (100%), Positives = 51/51 (100%) Frame = +3 Query: 3 KQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 155 KQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 558 KQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 608 >ref|XP_003546316.1| PREDICTED: ATP-citrate synthase beta chain protein 1-like [Glycine max] Length = 608 Score = 108 bits (270), Expect = 5e-22 Identities = 51/51 (100%), Positives = 51/51 (100%) Frame = +3 Query: 3 KQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 155 KQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 558 KQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 608