BLASTX nr result
ID: Bupleurum21_contig00013416
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00013416 (424 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003544337.1| PREDICTED: uncharacterized protein LOC100799... 64 1e-08 ref|XP_002887590.1| expressed protein [Arabidopsis lyrata subsp.... 64 1e-08 ref|NP_001117603.1| conserved peptide upstream open reading fram... 59 5e-07 >ref|XP_003544337.1| PREDICTED: uncharacterized protein LOC100799960 [Glycine max] gi|356564302|ref|XP_003550394.1| PREDICTED: uncharacterized protein LOC100799844 [Glycine max] Length = 41 Score = 64.3 bits (155), Expect = 1e-08 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 3/41 (7%) Frame = +1 Query: 253 MSPVISEILRSGFMINTYLR---HLVQSFSVCFLYWFYDFS 366 MSPV+SEILRSGFMIN+ LR HLVQSFSV FLYWFY FS Sbjct: 1 MSPVLSEILRSGFMINSSLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_002887590.1| expressed protein [Arabidopsis lyrata subsp. lyrata] gi|297333431|gb|EFH63849.1| expressed protein [Arabidopsis lyrata subsp. lyrata] Length = 53 Score = 63.9 bits (154), Expect = 1e-08 Identities = 34/48 (70%), Positives = 38/48 (79%), Gaps = 3/48 (6%) Frame = +1 Query: 232 ELDV*IYMSPVISEILRSGFMINTYLR---HLVQSFSVCFLYWFYDFS 366 +LDV +MSPVISEILRSG I++ LR HLVQSFSV FLYWFY FS Sbjct: 6 DLDVQTFMSPVISEILRSGLTIDSSLRRRTHLVQSFSVVFLYWFYVFS 53 >ref|NP_001117603.1| conserved peptide upstream open reading frame 5 [Arabidopsis thaliana] gi|332197591|gb|AEE35712.1| conserved peptide upstream open reading frame 5 [Arabidopsis thaliana] Length = 41 Score = 58.5 bits (140), Expect = 5e-07 Identities = 31/41 (75%), Positives = 33/41 (80%), Gaps = 3/41 (7%) Frame = +1 Query: 253 MSPVISEILRSGFMINTYLR---HLVQSFSVCFLYWFYDFS 366 MSPVISEILRSG I++ LR HLVQSFSV FLYWFY FS Sbjct: 1 MSPVISEILRSGLTIDSSLRRRTHLVQSFSVVFLYWFYVFS 41