BLASTX nr result
ID: Bupleurum21_contig00013305
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00013305 (669 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528989.1| conserved hypothetical protein [Ricinus comm... 58 1e-06 ref|XP_003602011.1| Apoptotic chromatin condensation inducer in ... 58 2e-06 gb|ABF96287.1| SAP domain containing protein, expressed [Oryza s... 55 9e-06 >ref|XP_002528989.1| conserved hypothetical protein [Ricinus communis] gi|223531579|gb|EEF33408.1| conserved hypothetical protein [Ricinus communis] Length = 661 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/46 (60%), Positives = 33/46 (71%) Frame = -3 Query: 331 SSYPVLNDKPIDQWKVTELKEEXXXXXXXXXXXKDDLIRRLDESLR 194 S YP+L ++PIDQWKVTELKEE KDDLI+RLDE+LR Sbjct: 3 SKYPILENRPIDQWKVTELKEELKRRKLTTKGLKDDLIKRLDEALR 48 >ref|XP_003602011.1| Apoptotic chromatin condensation inducer in the nucleus [Medicago truncatula] gi|355491059|gb|AES72262.1| Apoptotic chromatin condensation inducer in the nucleus [Medicago truncatula] Length = 720 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/46 (60%), Positives = 33/46 (71%) Frame = -3 Query: 331 SSYPVLNDKPIDQWKVTELKEEXXXXXXXXXXXKDDLIRRLDESLR 194 S YP+L+DKPID+WKVTELKEE K+DLI RLDE+LR Sbjct: 5 SKYPILDDKPIDKWKVTELKEELKRRKLVTKGLKEDLINRLDEALR 50 >gb|ABF96287.1| SAP domain containing protein, expressed [Oryza sativa Japonica Group] gi|108708493|gb|ABF96288.1| SAP domain containing protein, expressed [Oryza sativa Japonica Group] Length = 715 Score = 55.5 bits (132), Expect = 9e-06 Identities = 26/47 (55%), Positives = 35/47 (74%) Frame = -3 Query: 334 MSSYPVLNDKPIDQWKVTELKEEXXXXXXXXXXXKDDLIRRLDESLR 194 MSSYPVLN++PIDQW+VT+LK+E KD+L+RRL ES++ Sbjct: 1 MSSYPVLNNRPIDQWRVTDLKDELRKRRLPVKGLKDELVRRLFESIQ 47