BLASTX nr result
ID: Bupleurum21_contig00013155
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00013155 (498 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002523560.1| conserved hypothetical protein [Ricinus comm... 59 3e-07 >ref|XP_002523560.1| conserved hypothetical protein [Ricinus communis] gi|223537122|gb|EEF38755.1| conserved hypothetical protein [Ricinus communis] Length = 219 Score = 59.3 bits (142), Expect = 3e-07 Identities = 29/66 (43%), Positives = 38/66 (57%), Gaps = 2/66 (3%) Frame = +2 Query: 257 ESVVQDSTSEISCGRQT--TTEKMPSXXXXXXXXXXXXRNLQKQFRDKYNYDISTDEPLN 430 +S + S E + R+ T EKMP+ RN+QK+F DKYNYD+ DEPL Sbjct: 150 DSTARPSAMEANSRRKPSLTVEKMPTETELDEFFAEAERNIQKRFADKYNYDVVKDEPLK 209 Query: 431 GRYEWL 448 GRYEW+ Sbjct: 210 GRYEWV 215