BLASTX nr result
ID: Bupleurum21_contig00012168
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00012168 (424 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002272463.2| PREDICTED: uncharacterized protein LOC100261... 66 3e-09 >ref|XP_002272463.2| PREDICTED: uncharacterized protein LOC100261429 [Vitis vinifera] gi|296086737|emb|CBI32372.3| unnamed protein product [Vitis vinifera] Length = 276 Score = 65.9 bits (159), Expect = 3e-09 Identities = 32/63 (50%), Positives = 44/63 (69%), Gaps = 2/63 (3%) Frame = +1 Query: 76 ILPLRLRFKCKNQNRELDASCLDSSYANST--DSLDTASNDLIWFQCRHVIKGMAC*TSP 249 I+P RL+ KC+ +N+E+D DS ANS+ + D++S+DLIWFQCRHVIKG+A Sbjct: 214 IIPFRLQLKCRTRNQEMDTPHHDSQTANSSSINLTDSSSDDLIWFQCRHVIKGLASKAPS 273 Query: 250 AEE 258 EE Sbjct: 274 MEE 276