BLASTX nr result
ID: Bupleurum21_contig00011745
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00011745 (265 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK41352.1| unknown [Lotus japonicus] 65 6e-09 ref|XP_003531078.1| PREDICTED: 26S proteasome non-ATPase regulat... 65 6e-09 ref|NP_001241171.1| uncharacterized protein LOC100785835 [Glycin... 65 6e-09 ref|XP_002518856.1| 26S proteasome non-atpase regulatory subunit... 65 6e-09 ref|XP_002303668.1| predicted protein [Populus trichocarpa] gi|1... 65 6e-09 >gb|AFK41352.1| unknown [Lotus japonicus] Length = 124 Score = 65.1 bits (157), Expect = 6e-09 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -1 Query: 265 FQKAKESAPCKEIPSLQLITQTLSYARELERIV 167 FQKAKESAPCKEIPSLQLI QTLSYARELERIV Sbjct: 92 FQKAKESAPCKEIPSLQLINQTLSYARELERIV 124 >ref|XP_003531078.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit RPN12A-like [Glycine max] Length = 267 Score = 65.1 bits (157), Expect = 6e-09 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -1 Query: 265 FQKAKESAPCKEIPSLQLITQTLSYARELERIV 167 FQKAKESAPCKEIPSLQLI QTLSYARELERIV Sbjct: 235 FQKAKESAPCKEIPSLQLINQTLSYARELERIV 267 >ref|NP_001241171.1| uncharacterized protein LOC100785835 [Glycine max] gi|255634606|gb|ACU17665.1| unknown [Glycine max] Length = 267 Score = 65.1 bits (157), Expect = 6e-09 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -1 Query: 265 FQKAKESAPCKEIPSLQLITQTLSYARELERIV 167 FQKAKESAPCKEIPSLQLI QTLSYARELERIV Sbjct: 235 FQKAKESAPCKEIPSLQLINQTLSYARELERIV 267 >ref|XP_002518856.1| 26S proteasome non-atpase regulatory subunit, putative [Ricinus communis] gi|223541843|gb|EEF43389.1| 26S proteasome non-atpase regulatory subunit, putative [Ricinus communis] Length = 267 Score = 65.1 bits (157), Expect = 6e-09 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -1 Query: 265 FQKAKESAPCKEIPSLQLITQTLSYARELERIV 167 FQKAKESAPCKEIPSLQLI QTLSYARELERIV Sbjct: 235 FQKAKESAPCKEIPSLQLINQTLSYARELERIV 267 >ref|XP_002303668.1| predicted protein [Populus trichocarpa] gi|118488523|gb|ABK96074.1| unknown [Populus trichocarpa] gi|222841100|gb|EEE78647.1| predicted protein [Populus trichocarpa] Length = 267 Score = 65.1 bits (157), Expect = 6e-09 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -1 Query: 265 FQKAKESAPCKEIPSLQLITQTLSYARELERIV 167 FQKAKESAPCKEIPSLQLI QTLSYARELERIV Sbjct: 235 FQKAKESAPCKEIPSLQLINQTLSYARELERIV 267