BLASTX nr result
ID: Bupleurum21_contig00010742
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00010742 (1086 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAL68175.1| ethylene response factor #231 [Nicotiana tabacum] 57 6e-06 >dbj|BAL68175.1| ethylene response factor #231 [Nicotiana tabacum] Length = 257 Score = 57.4 bits (137), Expect = 6e-06 Identities = 32/68 (47%), Positives = 38/68 (55%), Gaps = 17/68 (25%) Frame = -1 Query: 669 PMRESGGNGVDEPHAPPAERT-------------AEIRDRMGRCRHWLGTFG----VARA 541 P + GG +E P ER+ AEIRDR+GRCRHWLGTF ARA Sbjct: 104 PDKYRGGARKEEKRNVPVERSYRGVRKRPWGRWSAEIRDRIGRCRHWLGTFDTPEEAARA 163 Query: 540 YDSAARWM 517 YD+AARW+ Sbjct: 164 YDAAARWL 171