BLASTX nr result
ID: Bupleurum21_contig00009772
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00009772 (996 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAB88648.1| microtubule bundling polypeptide TMBP200 [Nicoti... 64 1e-19 ref|XP_002300496.1| microtubule organization protein [Populus tr... 60 2e-18 ref|XP_003535517.1| PREDICTED: protein MOR1-like [Glycine max] 60 5e-18 ref|XP_002317062.1| microtubule organization protein [Populus tr... 58 3e-17 ref|XP_002534264.1| microtubule associated protein xmap215, puta... 64 4e-17 >dbj|BAB88648.1| microtubule bundling polypeptide TMBP200 [Nicotiana tabacum] Length = 2029 Score = 63.5 bits (153), Expect(2) = 1e-19 Identities = 30/48 (62%), Positives = 36/48 (75%) Frame = +1 Query: 340 IKRFWRCIQLLKPVAAAVTDKSEDVRKAAEVCFDEILKVCGHEMKHMN 483 +K F + LLKPVA+A+TDKS DVRKAAE CF E+L+VCG EM N Sbjct: 1005 MKEFPDAVHLLKPVASAMTDKSADVRKAAEACFGELLRVCGQEMVSKN 1052 Score = 60.1 bits (144), Expect(2) = 1e-19 Identities = 28/45 (62%), Positives = 32/45 (71%) Frame = +2 Query: 227 AVDKASKVPYFAAALMDAKFGAEGRRDLFEWLSRQLAGSKDFGDA 361 AV VPY AL DAK GAEGR+DLF+WLS+QL G K+F DA Sbjct: 967 AVHLDKMVPYITGALTDAKLGAEGRKDLFDWLSKQLTGMKEFPDA 1011 >ref|XP_002300496.1| microtubule organization protein [Populus trichocarpa] gi|222847754|gb|EEE85301.1| microtubule organization protein [Populus trichocarpa] Length = 2036 Score = 60.5 bits (145), Expect(2) = 2e-18 Identities = 27/45 (60%), Positives = 34/45 (75%) Frame = +2 Query: 227 AVDKASKVPYFAAALMDAKFGAEGRRDLFEWLSRQLAGSKDFGDA 361 AV VPY AAL++ K GAEGR+DLF+WLS+QL+GS +F DA Sbjct: 974 AVHLDKMVPYITAALIETKLGAEGRKDLFDWLSKQLSGSSEFSDA 1018 Score = 58.5 bits (140), Expect(2) = 2e-18 Identities = 28/45 (62%), Positives = 32/45 (71%) Frame = +1 Query: 349 FWRCIQLLKPVAAAVTDKSEDVRKAAEVCFDEILKVCGHEMKHMN 483 F I LLKP ++A+TDKS DVRKAAE C EIL+VCG EM N Sbjct: 1015 FSDAIHLLKPASSAMTDKSSDVRKAAEACISEILRVCGQEMIEKN 1059 >ref|XP_003535517.1| PREDICTED: protein MOR1-like [Glycine max] Length = 2035 Score = 60.5 bits (145), Expect(2) = 5e-18 Identities = 29/50 (58%), Positives = 34/50 (68%) Frame = +2 Query: 212 DVMPPAVDKASKVPYFAAALMDAKFGAEGRRDLFEWLSRQLAGSKDFGDA 361 D AV VPY A ALMD+K GAEGR+DLF+WLSRQL+G F +A Sbjct: 969 DAWLAAVHLDKMVPYIAIALMDSKLGAEGRKDLFDWLSRQLSGLSSFAEA 1018 Score = 57.4 bits (137), Expect(2) = 5e-18 Identities = 26/44 (59%), Positives = 33/44 (75%) Frame = +1 Query: 340 IKRFWRCIQLLKPVAAAVTDKSEDVRKAAEVCFDEILKVCGHEM 471 + F QLLKP ++A+TDKS DVRKA+E C +EIL+V GHEM Sbjct: 1012 LSSFAEAAQLLKPASSAMTDKSSDVRKASEACINEILRVSGHEM 1055 >ref|XP_002317062.1| microtubule organization protein [Populus trichocarpa] gi|222860127|gb|EEE97674.1| microtubule organization protein [Populus trichocarpa] Length = 2025 Score = 58.2 bits (139), Expect(2) = 3e-17 Identities = 28/48 (58%), Positives = 32/48 (66%) Frame = +1 Query: 340 IKRFWRCIQLLKPVAAAVTDKSEDVRKAAEVCFDEILKVCGHEMKHMN 483 + F I LLKP +A+TDKS DVRKAAE C EIL+VCG EM N Sbjct: 1009 LSEFPDAIHLLKPAGSAMTDKSADVRKAAEACISEILRVCGQEMIERN 1056 Score = 57.0 bits (136), Expect(2) = 3e-17 Identities = 25/45 (55%), Positives = 33/45 (73%) Frame = +2 Query: 227 AVDKASKVPYFAAALMDAKFGAEGRRDLFEWLSRQLAGSKDFGDA 361 AV +PY AAL ++K GAEGR+DLF+WLS+QL+G +F DA Sbjct: 971 AVHLDKMIPYITAALFESKLGAEGRKDLFDWLSKQLSGLSEFPDA 1015 >ref|XP_002534264.1| microtubule associated protein xmap215, putative [Ricinus communis] gi|223525620|gb|EEF28119.1| microtubule associated protein xmap215, putative [Ricinus communis] Length = 1992 Score = 63.5 bits (153), Expect(2) = 4e-17 Identities = 29/45 (64%), Positives = 34/45 (75%) Frame = +2 Query: 227 AVDKASKVPYFAAALMDAKFGAEGRRDLFEWLSRQLAGSKDFGDA 361 AV +PY A AL+DAK GAEGR+DLF+WLSRQL+G DF DA Sbjct: 934 AVHLDKMIPYIATALIDAKLGAEGRKDLFDWLSRQLSGLSDFSDA 978 Score = 51.2 bits (121), Expect(2) = 4e-17 Identities = 24/45 (53%), Positives = 29/45 (64%) Frame = +1 Query: 349 FWRCIQLLKPVAAAVTDKSEDVRKAAEVCFDEILKVCGHEMKHMN 483 F + LLKP +A+TDKS DVRKAAE C E+L+V G E N Sbjct: 975 FSDAVHLLKPAGSAMTDKSSDVRKAAEACITEVLRVSGQETVEKN 1019