BLASTX nr result
ID: Bupleurum21_contig00009606
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00009606 (428 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003593113.1| hypothetical protein MTR_2g007950 [Medicago ... 55 8e-06 >ref|XP_003593113.1| hypothetical protein MTR_2g007950 [Medicago truncatula] gi|355482161|gb|AES63364.1| hypothetical protein MTR_2g007950 [Medicago truncatula] gi|388504710|gb|AFK40421.1| unknown [Medicago truncatula] Length = 73 Score = 54.7 bits (130), Expect = 8e-06 Identities = 21/31 (67%), Positives = 23/31 (74%) Frame = +1 Query: 316 DCIDACYTGCVSNDSRAMSRCEGKCRIRCGP 408 DC+D C TGCV DSR +RCE KC IRCGP Sbjct: 34 DCLDGCQTGCVQRDSRLTARCERKCSIRCGP 64