BLASTX nr result
ID: Bupleurum21_contig00009426
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00009426 (693 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_973517.1| serine carboxypeptidase-like 9 [Arabidopsis tha... 93 6e-17 ref|NP_179884.1| serine carboxypeptidase-like 9 [Arabidopsis tha... 93 6e-17 ref|XP_003604930.1| Serine carboxypeptidase family protein [Medi... 92 1e-16 ref|XP_003604927.1| Serine carboxypeptidase [Medicago truncatula... 91 2e-16 ref|XP_003604931.1| Serine carboxypeptidase [Medicago truncatula... 91 3e-16 >ref|NP_973517.1| serine carboxypeptidase-like 9 [Arabidopsis thaliana] gi|330252302|gb|AEC07396.1| serine carboxypeptidase-like 9 [Arabidopsis thaliana] Length = 437 Score = 92.8 bits (229), Expect = 6e-17 Identities = 39/47 (82%), Positives = 45/47 (95%) Frame = -3 Query: 691 VPFQSTQAWIRELNYSIIDDWRPWIVEGQYAGYTRTYSNKMTFATVK 551 +PFQ+TQAWI+ LNYSIIDDWRPW+++GQ AGYTRTYSNKMTFATVK Sbjct: 365 MPFQATQAWIKSLNYSIIDDWRPWMIKGQIAGYTRTYSNKMTFATVK 411 >ref|NP_179884.1| serine carboxypeptidase-like 9 [Arabidopsis thaliana] gi|75099209|sp|O64811.1|SCP9_ARATH RecName: Full=Serine carboxypeptidase-like 9; Flags: Precursor gi|3169175|gb|AAC17818.1| putative serine carboxypeptidase I [Arabidopsis thaliana] gi|330252303|gb|AEC07397.1| serine carboxypeptidase-like 9 [Arabidopsis thaliana] Length = 437 Score = 92.8 bits (229), Expect = 6e-17 Identities = 39/47 (82%), Positives = 45/47 (95%) Frame = -3 Query: 691 VPFQSTQAWIRELNYSIIDDWRPWIVEGQYAGYTRTYSNKMTFATVK 551 +PFQ+TQAWI+ LNYSIIDDWRPW+++GQ AGYTRTYSNKMTFATVK Sbjct: 365 MPFQATQAWIKSLNYSIIDDWRPWMIKGQIAGYTRTYSNKMTFATVK 411 >ref|XP_003604930.1| Serine carboxypeptidase family protein [Medicago truncatula] gi|355505985|gb|AES87127.1| Serine carboxypeptidase family protein [Medicago truncatula] Length = 981 Score = 92.0 bits (227), Expect = 1e-16 Identities = 40/47 (85%), Positives = 43/47 (91%) Frame = -3 Query: 691 VPFQSTQAWIRELNYSIIDDWRPWIVEGQYAGYTRTYSNKMTFATVK 551 VPFQSTQAWIR+LNYSI+DDWR W V GQ AGYTRTYSN+MTFATVK Sbjct: 479 VPFQSTQAWIRDLNYSIVDDWRSWFVNGQVAGYTRTYSNRMTFATVK 525 >ref|XP_003604927.1| Serine carboxypeptidase [Medicago truncatula] gi|355505982|gb|AES87124.1| Serine carboxypeptidase [Medicago truncatula] Length = 624 Score = 90.9 bits (224), Expect = 2e-16 Identities = 39/47 (82%), Positives = 41/47 (87%) Frame = -3 Query: 691 VPFQSTQAWIRELNYSIIDDWRPWIVEGQYAGYTRTYSNKMTFATVK 551 VPF STQAWIR LNYSI+DDWRPW V GQ GYTRTYSN+MTFATVK Sbjct: 395 VPFMSTQAWIRNLNYSIVDDWRPWFVNGQVGGYTRTYSNRMTFATVK 441 >ref|XP_003604931.1| Serine carboxypeptidase [Medicago truncatula] gi|355505986|gb|AES87128.1| Serine carboxypeptidase [Medicago truncatula] Length = 470 Score = 90.5 bits (223), Expect = 3e-16 Identities = 38/47 (80%), Positives = 42/47 (89%) Frame = -3 Query: 691 VPFQSTQAWIRELNYSIIDDWRPWIVEGQYAGYTRTYSNKMTFATVK 551 VPF STQAWIR+LNYSI+DDWRPW V GQ GYTRTY+N+MTFATVK Sbjct: 397 VPFMSTQAWIRDLNYSIVDDWRPWFVNGQVGGYTRTYANRMTFATVK 443