BLASTX nr result
ID: Bupleurum21_contig00009278
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00009278 (420 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002301391.1| predicted protein [Populus trichocarpa] gi|2... 80 1e-13 ref|NP_850733.1| POZ/BTB containin G-protein 1 [Arabidopsis thal... 79 4e-13 ref|NP_567115.1| POZ/BTB containin G-protein 1 [Arabidopsis thal... 79 4e-13 ref|XP_002876624.1| BTB/POZ domain-containing protein [Arabidops... 79 4e-13 emb|CAB71090.1| putative protein [Arabidopsis thaliana] 79 4e-13 >ref|XP_002301391.1| predicted protein [Populus trichocarpa] gi|222843117|gb|EEE80664.1| predicted protein [Populus trichocarpa] Length = 556 Score = 80.5 bits (197), Expect = 1e-13 Identities = 37/40 (92%), Positives = 37/40 (92%) Frame = +1 Query: 1 GGKAVGYRNLFGTPWTSFTAEDSPYFINGVLHLRAELTIR 120 GGKAVGYRNLF PWTSF AEDSPYFINGVLHLRAELTIR Sbjct: 516 GGKAVGYRNLFAIPWTSFMAEDSPYFINGVLHLRAELTIR 555 >ref|NP_850733.1| POZ/BTB containin G-protein 1 [Arabidopsis thaliana] gi|327488374|sp|Q9FPW6.2|POB1_ARATH RecName: Full=BTB/POZ domain-containing protein POB1; AltName: Full=POZ/BTB CONTAINING-PROTEIN 1; Short=AtPOB1 gi|332646708|gb|AEE80229.1| POZ/BTB containin G-protein 1 [Arabidopsis thaliana] Length = 561 Score = 79.0 bits (193), Expect = 4e-13 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = +1 Query: 1 GGKAVGYRNLFGTPWTSFTAEDSPYFINGVLHLRAELTIRQ 123 GGKAVGYRNLFG PWTSF AEDS YFING+LHLRAELTI++ Sbjct: 517 GGKAVGYRNLFGVPWTSFIAEDSQYFINGILHLRAELTIKR 557 >ref|NP_567115.1| POZ/BTB containin G-protein 1 [Arabidopsis thaliana] gi|12006855|gb|AAG44951.1|AF292397_1 POZ/BTB containing-protein AtPOB1 [Arabidopsis thaliana] gi|133778840|gb|ABO38760.1| At3g61600 [Arabidopsis thaliana] gi|332646709|gb|AEE80230.1| POZ/BTB containin G-protein 1 [Arabidopsis thaliana] Length = 561 Score = 79.0 bits (193), Expect = 4e-13 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = +1 Query: 1 GGKAVGYRNLFGTPWTSFTAEDSPYFINGVLHLRAELTIRQ 123 GGKAVGYRNLFG PWTSF AEDS YFING+LHLRAELTI++ Sbjct: 517 GGKAVGYRNLFGVPWTSFIAEDSQYFINGILHLRAELTIKR 557 >ref|XP_002876624.1| BTB/POZ domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297322462|gb|EFH52883.1| BTB/POZ domain-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 562 Score = 79.0 bits (193), Expect = 4e-13 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = +1 Query: 1 GGKAVGYRNLFGTPWTSFTAEDSPYFINGVLHLRAELTIRQ 123 GGKAVGYRNLFG PWTSF AEDS YFING+LHLRAELTI++ Sbjct: 518 GGKAVGYRNLFGVPWTSFIAEDSQYFINGILHLRAELTIKR 558 >emb|CAB71090.1| putative protein [Arabidopsis thaliana] Length = 545 Score = 79.0 bits (193), Expect = 4e-13 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = +1 Query: 1 GGKAVGYRNLFGTPWTSFTAEDSPYFINGVLHLRAELTIRQ 123 GGKAVGYRNLFG PWTSF AEDS YFING+LHLRAELTI++ Sbjct: 501 GGKAVGYRNLFGVPWTSFIAEDSQYFINGILHLRAELTIKR 541