BLASTX nr result
ID: Bupleurum21_contig00009173
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00009173 (325 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADN34058.1| adenylyl-sulfate reductase [Cucumis melo subsp. m... 74 2e-11 ref|NP_001233829.1| adenylyl-sulfate reductase [Solanum lycopers... 73 2e-11 gb|AFK34024.1| unknown [Lotus japonicus] 71 8e-11 ref|XP_004155612.1| PREDICTED: 5'-adenylylsulfate reductase 3, c... 70 2e-10 ref|XP_004134768.1| PREDICTED: 5'-adenylylsulfate reductase 3, c... 70 2e-10 >gb|ADN34058.1| adenylyl-sulfate reductase [Cucumis melo subsp. melo] Length = 465 Score = 73.6 bits (179), Expect = 2e-11 Identities = 33/39 (84%), Positives = 38/39 (97%) Frame = -3 Query: 323 QLGTFPTILFYPKHSSRAVKYPSENRDVESLLAFVNALR 207 QLG+FPTILF+PKHSS+A+KYPSE RDVESL+AFVNALR Sbjct: 427 QLGSFPTILFFPKHSSKAIKYPSEKRDVESLMAFVNALR 465 >ref|NP_001233829.1| adenylyl-sulfate reductase [Solanum lycopersicum] gi|51457940|gb|AAU03359.1| adenylyl-sulfate reductase [Solanum lycopersicum] Length = 461 Score = 73.2 bits (178), Expect = 2e-11 Identities = 33/39 (84%), Positives = 38/39 (97%) Frame = -3 Query: 323 QLGTFPTILFYPKHSSRAVKYPSENRDVESLLAFVNALR 207 QLG+FPTILF+PKHSS+A+KYPSE RDV+SLLAFVNALR Sbjct: 423 QLGSFPTILFFPKHSSKAIKYPSEKRDVDSLLAFVNALR 461 >gb|AFK34024.1| unknown [Lotus japonicus] Length = 461 Score = 71.2 bits (173), Expect = 8e-11 Identities = 31/38 (81%), Positives = 37/38 (97%) Frame = -3 Query: 320 LGTFPTILFYPKHSSRAVKYPSENRDVESLLAFVNALR 207 LG+FPTI+F+PKHSSR +KYPSENRDV+SL+AFVNALR Sbjct: 424 LGSFPTIMFFPKHSSRPIKYPSENRDVDSLMAFVNALR 461 >ref|XP_004155612.1| PREDICTED: 5'-adenylylsulfate reductase 3, chloroplastic-like [Cucumis sativus] Length = 463 Score = 70.1 bits (170), Expect = 2e-10 Identities = 31/39 (79%), Positives = 36/39 (92%) Frame = -3 Query: 323 QLGTFPTILFYPKHSSRAVKYPSENRDVESLLAFVNALR 207 QLG+FPTILF+PKHSSR +KYPSE RDV+SL+AFVNA R Sbjct: 425 QLGSFPTILFFPKHSSRPIKYPSEKRDVDSLMAFVNAFR 463 >ref|XP_004134768.1| PREDICTED: 5'-adenylylsulfate reductase 3, chloroplastic-like [Cucumis sativus] Length = 463 Score = 70.1 bits (170), Expect = 2e-10 Identities = 31/39 (79%), Positives = 36/39 (92%) Frame = -3 Query: 323 QLGTFPTILFYPKHSSRAVKYPSENRDVESLLAFVNALR 207 QLG+FPTILF+PKHSSR +KYPSE RDV+SL+AFVNA R Sbjct: 425 QLGSFPTILFFPKHSSRPIKYPSEKRDVDSLMAFVNAFR 463