BLASTX nr result
ID: Bupleurum21_contig00006975
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00006975 (433 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI36825.3| unnamed protein product [Vitis vinifera] 157 8e-37 ref|XP_002263353.1| PREDICTED: putative indole-3-acetic acid-ami... 157 8e-37 ref|XP_003598911.1| Indole-3-acetic acid-amido synthetase GH3.5 ... 155 3e-36 ref|XP_003536201.1| PREDICTED: putative indole-3-acetic acid-ami... 154 9e-36 ref|XP_003518956.1| PREDICTED: putative indole-3-acetic acid-ami... 152 3e-35 >emb|CBI36825.3| unnamed protein product [Vitis vinifera] Length = 548 Score = 157 bits (397), Expect = 8e-37 Identities = 75/95 (78%), Positives = 86/95 (90%) Frame = +2 Query: 35 LDFNVLEDCCIAVEEELDYNYRRCRANDKSIGPLEIRVVKPGTFESLMDLFINKGGSINQ 214 LD VLE+CCIAVEEELDY YRRCR +DKS+GPLEIR+V+PGTFE LMDLFI++GGSINQ Sbjct: 455 LDSKVLEECCIAVEEELDYIYRRCRTHDKSVGPLEIRLVQPGTFEDLMDLFISQGGSINQ 514 Query: 215 YKTPRCIKSNDDALKLLDSNVKARFFSPRDPMWSP 319 YKTPRCIKS+ +ALKLL+SNV+A FFSPRDP W P Sbjct: 515 YKTPRCIKSS-NALKLLNSNVEASFFSPRDPRWIP 548 >ref|XP_002263353.1| PREDICTED: putative indole-3-acetic acid-amido synthetase GH3.9 [Vitis vinifera] Length = 596 Score = 157 bits (397), Expect = 8e-37 Identities = 75/95 (78%), Positives = 86/95 (90%) Frame = +2 Query: 35 LDFNVLEDCCIAVEEELDYNYRRCRANDKSIGPLEIRVVKPGTFESLMDLFINKGGSINQ 214 LD VLE+CCIAVEEELDY YRRCR +DKS+GPLEIR+V+PGTFE LMDLFI++GGSINQ Sbjct: 503 LDSKVLEECCIAVEEELDYIYRRCRTHDKSVGPLEIRLVQPGTFEDLMDLFISQGGSINQ 562 Query: 215 YKTPRCIKSNDDALKLLDSNVKARFFSPRDPMWSP 319 YKTPRCIKS+ +ALKLL+SNV+A FFSPRDP W P Sbjct: 563 YKTPRCIKSS-NALKLLNSNVEASFFSPRDPRWIP 596 >ref|XP_003598911.1| Indole-3-acetic acid-amido synthetase GH3.5 [Medicago truncatula] gi|355487959|gb|AES69162.1| Indole-3-acetic acid-amido synthetase GH3.5 [Medicago truncatula] Length = 128 Score = 155 bits (392), Expect = 3e-36 Identities = 76/97 (78%), Positives = 81/97 (83%) Frame = +2 Query: 29 EQLDFNVLEDCCIAVEEELDYNYRRCRANDKSIGPLEIRVVKPGTFESLMDLFINKGGSI 208 + LD NVL+ CCIAVEEELDY YRRCR NDKS+GPLEIRVV+PGTFE+LMDLFI KG SI Sbjct: 32 DPLDPNVLQGCCIAVEEELDYVYRRCRTNDKSVGPLEIRVVEPGTFEALMDLFITKGASI 91 Query: 209 NQYKTPRCIKSNDDALKLLDSNVKARFFSPRDPMWSP 319 NQYKTPRCIKS ALKLL S V A FFSPRDP W P Sbjct: 92 NQYKTPRCIKSK-KALKLLKSKVSASFFSPRDPKWGP 127 >ref|XP_003536201.1| PREDICTED: putative indole-3-acetic acid-amido synthetase GH3.9-like [Glycine max] Length = 608 Score = 154 bits (388), Expect = 9e-36 Identities = 76/105 (72%), Positives = 87/105 (82%) Frame = +2 Query: 5 TTINEILAEQLDFNVLEDCCIAVEEELDYNYRRCRANDKSIGPLEIRVVKPGTFESLMDL 184 TT + + LD NVLE+CCIAVEE+LDY YRRCR+ DKS+GPLEIRVV+PGTF++LMDL Sbjct: 500 TTESSQQLQLLDANVLEECCIAVEEQLDYVYRRCRSYDKSVGPLEIRVVEPGTFDALMDL 559 Query: 185 FINKGGSINQYKTPRCIKSNDDALKLLDSNVKARFFSPRDPMWSP 319 FI++G SINQYKTPRCIKS ALKLL S V A FFSPRDP WSP Sbjct: 560 FISQGASINQYKTPRCIKSK-KALKLLKSKVTASFFSPRDPKWSP 603 >ref|XP_003518956.1| PREDICTED: putative indole-3-acetic acid-amido synthetase GH3.9-like [Glycine max] Length = 606 Score = 152 bits (384), Expect = 3e-35 Identities = 74/96 (77%), Positives = 83/96 (86%) Frame = +2 Query: 32 QLDFNVLEDCCIAVEEELDYNYRRCRANDKSIGPLEIRVVKPGTFESLMDLFINKGGSIN 211 QLD NVLE+CCIAVEE+LDY YRRCR+ DKS+GPLEIRVV+PGTF++LMDLFI +G SIN Sbjct: 507 QLDANVLEECCIAVEEQLDYVYRRCRSYDKSVGPLEIRVVEPGTFDALMDLFICQGASIN 566 Query: 212 QYKTPRCIKSNDDALKLLDSNVKARFFSPRDPMWSP 319 QYKTPRCIKS ALKLL S V A FFSPRDP W+P Sbjct: 567 QYKTPRCIKSK-KALKLLKSKVTASFFSPRDPKWAP 601