BLASTX nr result
ID: Bupleurum21_contig00006962
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00006962 (550 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEI98616.1| hypothetical protein 111O18.3 [Coffea canephora] 69 7e-13 ref|XP_002310208.1| predicted protein [Populus trichocarpa] gi|2... 76 4e-12 ref|XP_002525112.1| DNA-directed RNA polymerase, putative [Ricin... 71 1e-10 ref|XP_003611964.1| DNA-directed RNA polymerase III subunit RPC5... 67 1e-09 gb|EAZ42119.1| hypothetical protein OsJ_26678 [Oryza sativa Japo... 67 2e-09 >gb|AEI98616.1| hypothetical protein 111O18.3 [Coffea canephora] Length = 643 Score = 69.3 bits (168), Expect(2) = 7e-13 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = -3 Query: 113 VVREIDVYFTPNSDPDTQLYVMQYPLKPCWRPYELDD 3 +VREIDVY TP+ DP+T+LYV+QYPL+P WRPYELDD Sbjct: 107 IVREIDVYLTPSIDPNTKLYVLQYPLRPLWRPYELDD 143 Score = 29.3 bits (64), Expect(2) = 7e-13 Identities = 23/85 (27%), Positives = 29/85 (34%) Frame = -2 Query: 489 MDLDDLEAPGQVQSRRTRFAXXXXXXXXXXXSEQSHDPNSNLIPPVQHESAIDSGGIVKD 310 MD DDL+ P Q +R +RFA P + P A S I K Sbjct: 1 MDFDDLDEPSQAPTRPSRFA-----------------PKGSKFKPRTEPVAATSNSIAKK 43 Query: 309 ELEIPVPPTDAVKMDTNLKPDPIED 235 E E+ P + T ED Sbjct: 44 E-ELDSKPVSPINSSTTAAAGKAED 67 >ref|XP_002310208.1| predicted protein [Populus trichocarpa] gi|222853111|gb|EEE90658.1| predicted protein [Populus trichocarpa] Length = 667 Score = 75.9 bits (185), Expect = 4e-12 Identities = 31/37 (83%), Positives = 36/37 (97%) Frame = -3 Query: 113 VVREIDVYFTPNSDPDTQLYVMQYPLKPCWRPYELDD 3 VVREIDVY+TP+ DP+TQLYVMQYPL+PCWRPYELD+ Sbjct: 111 VVREIDVYYTPSVDPNTQLYVMQYPLRPCWRPYELDE 147 >ref|XP_002525112.1| DNA-directed RNA polymerase, putative [Ricinus communis] gi|223535571|gb|EEF37239.1| DNA-directed RNA polymerase, putative [Ricinus communis] Length = 677 Score = 70.9 bits (172), Expect = 1e-10 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = -3 Query: 113 VVREIDVYFTPNSDPDTQLYVMQYPLKPCWRPYELDD 3 +VREIDV+FTP+ D TQLYVMQYPL+PCWRPYELD+ Sbjct: 117 IVREIDVFFTPSIDSATQLYVMQYPLRPCWRPYELDE 153 >ref|XP_003611964.1| DNA-directed RNA polymerase III subunit RPC5 [Medicago truncatula] gi|358344405|ref|XP_003636280.1| DNA-directed RNA polymerase III subunit RPC5 [Medicago truncatula] gi|355502215|gb|AES83418.1| DNA-directed RNA polymerase III subunit RPC5 [Medicago truncatula] gi|355513299|gb|AES94922.1| DNA-directed RNA polymerase III subunit RPC5 [Medicago truncatula] Length = 683 Score = 67.4 bits (163), Expect = 1e-09 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = -3 Query: 113 VVREIDVYFTPNSDPDTQLYVMQYPLKPCWRPYELDD 3 VVREIDVYF+P+ D DT+LYVMQYPL+P WRPY+LD+ Sbjct: 108 VVREIDVYFSPSIDNDTKLYVMQYPLRPSWRPYDLDE 144 >gb|EAZ42119.1| hypothetical protein OsJ_26678 [Oryza sativa Japonica Group] Length = 673 Score = 67.0 bits (162), Expect = 2e-09 Identities = 29/39 (74%), Positives = 34/39 (87%), Gaps = 1/39 (2%) Frame = -3 Query: 116 HVVREIDVYFTPNS-DPDTQLYVMQYPLKPCWRPYELDD 3 +V+REIDVYFTP D DT LYVMQYPL+PCWRPYEL++ Sbjct: 113 YVLREIDVYFTPKPFDEDTMLYVMQYPLRPCWRPYELNE 151