BLASTX nr result
ID: Bupleurum21_contig00006810
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00006810 (1370 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002309354.1| predicted protein [Populus trichocarpa] gi|2... 61 6e-07 >ref|XP_002309354.1| predicted protein [Populus trichocarpa] gi|222855330|gb|EEE92877.1| predicted protein [Populus trichocarpa] Length = 291 Score = 61.2 bits (147), Expect = 6e-07 Identities = 29/61 (47%), Positives = 39/61 (63%) Frame = +2 Query: 1136 SKSEAKMECERPLQKKSPHKKKYWCEICQVRAFSEKVMNDHMKGKRHISRLNEYSTKNEA 1315 S +EA ER + K K K+WCE+CQ+ A+SE VM H KGK+H++RL + S EA Sbjct: 153 SMAEAVQTKERTPEIKMKKKFKFWCEMCQIGAYSEMVMEAHKKGKKHLARLQKSSQNGEA 212 Query: 1316 V 1318 V Sbjct: 213 V 213